KEGG   Agrobacterium rhizogenes: B0909_07965Help
Entry
B0909_07965       CDS       T04767                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aro  Agrobacterium rhizogenes
Pathway
aro00473  D-Alanine metabolism
aro01100  Metabolic pathways
aro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aro00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B0909_07965
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B0909_07965
Enzymes [BR:aro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B0909_07965
Peptidoglycan biosynthesis and degradation proteins [BR:aro01011]
 Precursor biosynthesis
  Racemase
   B0909_07965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AQS62191
UniProt: A0A178HAT6
LinkDB All DBs
Position
1:1574846..1576021
Genome map
AA seq 391 aa AA seqDB search
MTDDFEETFAGTETDAFEHAPLRLTVDLGALADNWRDMKKRSGKARTAAVVKADAYGLGI
EDCGATLYHAGARDFFVATVAEGATLRSYAPEARIFVLSGIWQGQERQVFDNDLVPVLAS
EEQLSFWMATVAERGDHPCALHVDTGFNRLGLPLDDALFLADDVTRPASFDPVLVLSHLA
CADTPSSPMNRAQLESFRKVSAAFEGIESSLSASAGIFLGPDYHFDLTRPGIALYGGEAV
NDVANPMRPVAKAEARIIQIREAGEGQTVSYGGSFLLKRASRLAIASVGYADGYQRSLSG
SGIPLREMGHGGAYGVVNDHRVPVAGRVTMDLTIFDVTDVPANAIRNGDYIELFGPNVPV
DETARAAGTIGYEMLTGLGLRYERQYLMADD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgacttcgaagagactttcgccggaacagaaaccgacgctttcgagcacgca
ccgttgaggctgaccgtcgatcttggcgcgctggccgataactggcgggacatgaagaag
cggtccggcaaggcgcggacggcggctgtcgtcaaggccgatgcttacggcctcggtatc
gaggattgcggcgccaccctgtaccatgccggtgcgcgggatttcttcgtggcgacggtg
gccgagggcgcgacgctgcgctcctatgccccggaagcgcgcatcttcgtgctctcagga
atctggcagggccaggaacggcaggtcttcgacaatgatctggtgccggtgctggcatcc
gaggagcagctgtccttctggatggcgacggtggccgagcgtggcgaccacccttgcgcg
ctgcatgtcgataccggtttcaatcgcctcgggctgccgctcgacgacgcgctgtttctg
gctgacgacgtcacacggccggcgagtttcgatccggttctggttctgtcgcatctcgcc
tgcgccgacacgccctcctcgccgatgaacagggcccagctcgaatcattccggaaggtt
agcgccgcttttgaaggcatcgaatcaagcctctcggcttccgccggcatctttctcggc
cccgactatcactttgacctcacccgccctggcatcgccctttatggcggcgaagcggtc
aacgacgtggccaaccccatgcggcctgtggcgaaggctgaggcgcggatcatccagata
cgtgaggcgggtgaaggccagactgtcagctatggcggcagcttcctgctgaagcgtgca
agccggcttgccatcgcatccgtcggatatgcggacggataccagcgttcgctctcgggt
tcaggcattcccctgcgtgaaatgggccatggcggcgcctatggcgtggtcaacgatcac
agggtgccggtggctggccgcgtgaccatggacctcaccatctttgacgtcacggatgtg
ccggcaaatgccattcgcaacggcgactatatcgagctttttggtcccaacgtaccggtc
gacgagaccgcacgggcggccggcaccatcggctacgagatgctgacggggcttggcctg
cgctacgagcggcaatatctgatggccgacgactga

DBGET integrated database retrieval system