KEGG   Arthrospira platensis: NIES39_Q02830Help
Entry
NIES39_Q02830     CDS       T02608                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
arp  Arthrospira platensis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIES39_Q02830 (ppc)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIES39_Q02830 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES39_Q02830 (ppc)
   00680 Methane metabolism
    NIES39_Q02830 (ppc)
Enzymes [BR:arp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NIES39_Q02830 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6596868..6599975
Genome map
AA seq 1035 aa AA seqDB search
MSSLVQSSEPIPSAVVSSNAPVQASDLLLRNRLKIVEDLWESVLRQECGEQLVDLLLQMR
SMTSPEGQASPHLQANVWQIIKDLDINAAIRAARAFALYFQLINIVEQHYEQREQELAYA
QIKHQGPAESPADKSNRSIFETRHQRFSTAEEAPVELLNQTSRRQDDRDLATFHNLFPML
QRLNVPSQVIQRLLNQLDIRLVFTAHPTEIVRHTIRTKQRRIAKILQQLDTVDESYGKVD
NTNPEATGLVKTWTGELQEQLTEEIRLWWRTDELHQFKPTVLDEVEYSLHYFQEILFDVI
PQLYQRIKQTLQPHFPHLKPPNYDFCKFGSWVGADRDGNPSVTPEVTWKTACYQRGLIIN
KYIQAVDHLNQLLSLSLHWSDVLPELLESLDRDQVQLPEVYDQVAIRYRQEPYRLKLCYI
LKRLENTRDRNQRLSTSNEVERERERIVTKENAGSLYHSGAAFLKELKLIERNLMATGIQ
CRDLENLICQVEIYGFYLARMDMRQESSVHSTALNEIVDYLQLLARPYDDLTEAERTLWL
ITELQTRRPLIPAELPFSPKTCETINTFRVMRELQQEFGQEICQTYIISMSHDVSDLLEV
LLLAKEAGLYDPATGIGNLQVVPLFETVEDLKKAPSVMKDLFELPLYRAMLAGGYQKYEQ
VSQDVNASLQEIMLGYSDSNKDSGFLSSNWEIHKAQKALQTLAESYHISIRIFHGRGGSV
GRGGGPAYKAILAQPGKSINGRIKITEQGEVLASKYSLSQLALYNLESVATAVIQASLLH
TGFDEIEPWNQIMEELSVRSRSCYRALIYEQPDLVDFFEQVTPIQEISQLQISSRPARRQ
SDKKKDISGLRAIPWVFSWTQSRFLLPSWYGVGTAIEQFIREEPEENIKLLRYFYIKWPF
FRTTISKAEMTLAKVDLEMAHHYVRELSHPQDRDRFEDLFQRIAKEFNLTRQMVLEITGQ
KQLLDNDPVLQRSVRLRNGTIIPLGLLQVSLLQRLRHHGTSATPGVIHSRYSKGELLRGA
LLTINGIAAGMRNTG
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgagttcactggtccaatcctcagaaccaatccctagcgcagtagtttcatctaatgca
cctgtacaagcctctgacctgttgttaaggaatcgcctaaaaattgtcgaagatttatgg
gaaagtgtcctacgtcaggagtgcggagagcaattagtagatttacttctccaaatgcga
tcgatgacctcaccagaaggacaagcatcgccgcatttacaagccaatgtctggcaaatt
atcaaagatcttgatatcaatgcagctattcgagcagcgcgagcatttgccttgtatttt
caactgatcaacatagtcgagcaacattatgagcagcgcgagcaagagttagcctatgct
cagatcaaacaccaaggacccgcagagagtcccgccgacaagtcgaatcgctccattttt
gaaactcgtcatcagcgcttttccacagcagaagaagcaccagtagagctattaaatcaa
actagccgacgccaagacgatcgcgatttagccacattccataacctatttccgatgctg
caacggctaaacgtcccttcccaggtgattcagcgcctgctaaatcaactggatattagg
ctagtgtttacagctcaccccacagaaattgtacgccatacaatccgcaccaaacagagg
cggatcgccaaaattctccagcaactagacacagtagacgaaagttatggcaaagtagac
aatacaaatcccgaagccaccgggttagtaaaaacttggacaggcgaactacaagaacaa
ctaaccgaagaaataaggctgtggtggcgtactgatgaactgcaccaatttaagcccaca
gttttggatgaagtcgaatatagtttgcactatttccaggaaatcttatttgatgtaatt
ccgcaactgtaccaaaggattaaacaaaccctgcaaccccattttccccacctgaaacca
cccaactacgatttttgtaaatttgggtcctgggtgggagccgatcgcgatggtaacccg
tccgtcaccccagaagtcacctggaaaacagcctgttatcaacggggtctgattataaac
aaatacattcaagccgttgatcatctaaatcaactgttaagcctatctctgcattggagt
gacgttttaccagaattactcgaatctctagatcgcgatcaggtacaacttcccgaagtt
tatgatcaggtagccatccgctatcgccaagaaccctataggctgaaattatgctacatc
ctcaagcgcctagaaaatacccgcgatcgcaatcagagactttcgaccagtaacgaagta
gaaagagaacgcgagcgcattgtcaccaaagaaaacgccggaagtctctaccattcagga
gccgcatttctgaaggaattaaagctaattgagcggaacctaatggccacaggtattcaa
tgccgagatttagagaatctcatctgtcaagtggaaatttacggcttctatctagcgcgg
atggatatgcgccaggaatcgtccgtccatagtacagccttaaatgaaattgtagactat
ctgcaactactagcgaggccctacgatgacctgaccgaagccgagcgcaccctgtggcta
atcacagaattgcaaacccgccgccccctaattcccgccgagttacccttttccccaaaa
acctgtgaaaccattaacactttccgggtcatgcgagaattacagcaggaatttggtcag
gaaatttgccaaacctatattatcagcatgagtcatgatgttagtgacctgctagaggtg
ctgttgttagccaaggaagccggactgtatgacccagccacaggaattggtaatttgcag
gtagtacccctgtttgaaaccgtagaggatcttaaaaaagccccctcagtcatgaaagac
ttgtttgagttacccctatatcgggcgatgcttgcgggtggctaccagaaatatgagcag
gtcagccaagatgtgaacgcttctctacaggagattatgttaggttactccgacagtaat
aaggattcggggttcctcagtagcaactgggaaattcacaaagcccagaaagccctacaa
accttggctgaatcttaccatatcagtattcgcatctttcacggtcgcggtgggtctgtg
ggacgcggcggcggaccagcttacaaagccattttggctcaaccaggtaaaagtattaat
ggccgcattaagattaccgaacagggagaggttctcgcctccaaatattctctgtctcaa
ctggctctgtataatttggagagtgtagccacagcggtcattcaagctagtttactccat
accgggtttgatgaaattgaaccctggaatcaaatcatggaagagttatctgtgcgatcg
cgatcgtgttatcgagctttaatttatgaacagcccgacttagttgatttctttgagcag
gtaacacccattcaggaaattagccaattgcaaattagctcccgacccgctcgccgccaa
agtgacaagaaaaaagatatttccggtttacgagctattccttgggtgtttagttggact
cagagccgctttttgctaccctcttggtatggggtcggtacagccatagagcagtttatt
cgagaagaacccgaggaaaatatcaaactgctccgttacttttacatcaaatggccgttt
ttccgtaccaccatctctaaggcggaaatgaccctagctaaagttgacctagaaatggct
catcactatgtgcgggagttgagccatcctcaagatcgcgatcgctttgaggatctattt
cagcgtatagctaaagaatttaatctgacccgccaaatggttctggaaattaccggacag
aaacagttactagataatgatcccgtacttcagcgctcagtgcgactgcgtaatggcaca
attattcctctcggtttattgcaggtgtctttactccagcgcctgcgtcatcatggaact
tctgctactcccggagtaattcattcgagatatagtaaaggggaattgttgcgcggtgcc
ttattaaccatcaacggtatcgctgctggaatgcgtaacacaggctga

DBGET integrated database retrieval system