KEGG   Arthrobacter sp. QXT-31: BWQ92_16990Help
Entry
BWQ92_16990       CDS       T05056                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
arq  Arthrobacter sp. QXT-31
Pathway
arq00564  Glycerophospholipid metabolism
arq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BWQ92_16990
Enzymes [BR:arq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BWQ92_16990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored DnaG_DnaB_bind Pyr_redox_2 Pyr_redox 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: APX03186
UniProt: A0A1P8M512
LinkDB All DBs
Position
3739000..3740751
Genome map
AA seq 583 aa AA seqDB search
MNGFGERPAAARGALGPEAREAALAALKASAEPGKELDILIVGGGIVGTGVALDAVTRGL
NVGIVEASDWAAGTSSRSSKLIHGGLRYLEMLDFALVKEALQERGLLLSELAPHLARPVP
FLYPLTKHFVERPYIGAGIALYDAMSISGGHKRGVPFHKHLSRRGTLRAAPSLKDDAFVG
SIRYYDGQVDDAKYVANLVRTAAYYGAHAVNQTAVVDFLREGERVVGAKVVNREDGSSFN
IRAKQVINATGVWTDETQAMVTERGQLKVRASKGIHLVVPRDRFQSTVGLILRTEKSVLF
VIPWGRHWIIGTTDTDWHLDKAHPAASSKDIDYLLEHVNTVLKRPLTREDVEGVYAGLRP
LLAGESDSTAKLSREHVVAHPVPGLVVVAGGKWTTYRVMAKDAVDEAARSMDERVPQSCT
ETIPLLGASGFRAAWNRRNRTAEEFGVHVARVEHLLNRYGSMASEVLALIQERPELAEPL
PGADDYLQAEAVYAATHEGARHVHDVLTRRTRISIEAWDRGVSAVPVVAKLMGEILGWSD
AQRESEIKHYLARVEAERLSQQQPDDESADAARLGAEDIVPLR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtttcggtgaacgtccggcggctgccaggggcgccctggggcccgaggcgcgg
gaagccgcgctggctgcgctgaaggcatccgcggagccgggtaaggaactggacatcctc
atcgtcggcggcggcatcgtcggcaccggggtcgccctcgacgctgtgacccgcggcctg
aacgtgggcatcgtggaagccagcgactgggccgcggggacgtcgtcgcggtcctccaaa
ctcatccacggcggcctccgttacctggaaatgctcgacttcgcactcgtgaaggaggcg
ctgcaggaacgggggctgctgctttctgagctggcgccgcacctggcccggccggtgccg
ttcctgtacccgctcaccaagcacttcgtcgagcgcccctatatcggcgccggcatcgcg
ctgtacgacgccatgtccatctccggcgggcacaagcgcggcgtgccgttccacaagcac
ctgtcgcggcgcggcaccctgcgcgccgccccaagcctgaaggacgatgccttcgtcggc
tcgatccgctactacgacggccaagtggacgacgccaagtacgtagccaacctggtgcgg
acggccgcctactacggtgcccacgcagtcaaccagaccgccgtcgtcgacttcctccgc
gaaggggagcgtgtggtgggcgccaaggtggtcaaccgcgaggacggttccagcttcaac
atccgggcgaagcaggtcatcaacgccaccggcgtctggaccgacgaaacgcaggccatg
gtcaccgagcgcggccagctgaaggtgcgcgcgtccaagggtatccacctggtggtgccg
cgggaccgcttccagtcgactgtgggcctgatcctgcggaccgagaagtccgtgctgttc
gtcatcccgtgggggcggcactggatcatcggcacgacggataccgactggcatctggac
aaggcccaccccgcggcttccagtaaggacatcgattacctgctggagcacgtcaacacg
gtcctgaaacgccccctcacgcgggaagacgtggagggcgtctatgccggcctgcggccg
ctgctggccggggaaagcgactccaccgccaagctctcccgcgagcatgtcgttgcccat
cccgtgcccggcctggtggtggtggccggcggcaaatggaccacctaccgcgtcatggcc
aaggacgcggtggacgaggcggcccgcagcatggacgagcgcgtgccgcagagctgcacc
gagacgatcccgctgctgggagccagcggtttccgggccgcctggaaccgccgcaaccgg
acagccgaggaattcggtgtgcacgtggcacgggtggagcacctgctgaaccgttacggc
tccatggcgtcagaggtgctggcgctcatccaggaacggcccgaactggccgaaccgctg
cccggggccgacgactacctgcaggccgaggcggtctacgcggcgacccatgagggcgcc
cggcacgtgcacgacgtcctgacccggcggacccggatctccatcgaggcctgggaccgc
ggtgtgtctgccgtgccggtagtcgctaagcttatgggagaaattcttggctggagcgat
gcgcagcgggaaagcgaaatcaagcattacctggcgcgggtggaagccgaacggctgagc
cagcagcagcccgatgacgagtcggcggacgctgcccggctgggcgcggaggatatcgtc
ccgctgcgttga

DBGET integrated database retrieval system