KEGG   Arthrobacter sp. Rue61a: ARUE_c30140Help
Entry
ARUE_c30140       CDS       T02215                                 

Gene name
glpD2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00564  Glycerophospholipid metabolism
arr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ARUE_c30140 (glpD2)
Enzymes [BR:arr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ARUE_c30140 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 AlaDh_PNT_C Pyr_redox NAD_binding_8 Herpes_UL4
Motif
Other DBs
NCBI-ProteinID: AFR29899
UniProt: J7LYK6
LinkDB All DBs
Position
complement(3316073..3317827)
Genome map
AA seq 584 aa AA seqDB search
MSNVAGGPQVNSPGALSPESRAASIEVLKATAQAGKELDILIVGGGVVGAGAALDAVTRG
LTVGIVEARDWASGTSSRSSKLIHGGLRYLEMLDFGLVQEALQERGLLIQQIAPHLVRPV
PFLYPLTRRIWERPYVGAGIMLYDTLGLTSGHSRGVPMHKHLFRRGTLRAAPSLKEDAFV
GSIRYYDAQVDDARLVVNLVRTAAHYGAHAANRVRVVDFLREGERVVGAKVENQEDGSVF
EIRAKQVVNATGVWTDETQAMVTDRGQLKVRASKGIHLVVPRDRFQSTVGLILRTEKSVL
FVIPWGRHWIIGTTDTDWTLDKAHPAASSKDIDYVLEHVNKVLKRPLTREDVEGVYAGLR
PLLAGDNDSTAKLSREHVVAHPVPGLVVVAGGKYTTYRVMAKDAVDEATRAMDERVPSSC
TETIPLLGAEGFKAAWNRRGRSAEQAGVHVARVEHLLNRFGSMTPEVLDIIAGRPELGEP
LPGADDYLAAEVVYATTHEGARHVDDVLTRRTRISIEAWDRGVSAAPVVAKLMGEILGWS
ETQRESEIKHYLARVEAERLSQQQPDDESADAARMGVDDIVPLR
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtcgcaggcggtccgcaggtgaattctccgggagcactgagcccggaatcc
cgtgccgcatcgatcgaagtcctgaaagccactgcccaggcgggcaaagagctcgacatc
ctgattgtcgggggaggcgtagtgggagccggcgcagccctggatgccgtgacgcgtggc
ctcacagtgggcatcgtcgaggcccgggactgggcatcgggcacctcgtcccgatcgtcc
aagctcatccacggtggactgcggtacttggagatgcttgattttggcctcgtccaggaa
gcactacaagagcgggggctgctgatccaacagatcgcaccgcacctggtgcgcccggtc
cccttcctgtatccgctgacgcgccgtatttgggagcgtccgtatgtgggcgcaggcatc
atgctctacgacaccctgggtctgacctccggccacagccggggcgtccccatgcataag
cacctgttccgacgaggaaccctgcgggcagctcctagcctcaaagaagatgccttcgtt
gggtccatccgttactacgatgcccaggtggatgatgcccgcctggtggtcaacctcgta
aggactgcggcgcactacggtgcccacgcagcgaaccgtgtccgcgtggtggatttcctc
cgcgaaggggaacgcgtcgtcggggcaaaggttgaaaaccaggaagacggcagcgtcttc
gaaatcagggccaagcaagtggtcaacgctaccggcgtatggaccgacgaaacgcaggca
atggtgacggaccgtggtcagctgaaggtccgcgcatccaaaggaatccacctggtggtg
ccgcgggaccgcttccagtccacggtgggattgattctgcgcaccgaaaagtcagtgctc
tttgtgatcccctggggccggcactggatcatcggcactacagataccgactggacgctg
gataaggcacacccggcagcttccagcaaggacattgattatgtgcttgagcatgtcaac
aaggtcctcaagcgtccgctgacccgtgaggacgtggaaggcgtgtacgcaggcctacgc
ccgctgctggccggtgacaacgactccactgccaagctgtcccgcgagcatgttgtggcg
cacccggtgccgggactcgtcgtcgtggccggcgggaagtacaccacctaccgcgtcatg
gccaaagacgccgtggacgaggcaacccgggccatggacgagcgtgttccgtccagctgc
actgaaaccattccgctcctgggagcggagggattcaaagcggcgtggaaccgacgcggg
aggtcggccgaacaggctggcgtgcacgttgcacgcgtggagcacctgctcaaccgcttc
ggatccatgacaccggaagtcctggatatcattgccggccggccggaactgggggagccc
cttcccggagcggatgactacctggccgcagaagtcgtctacgcaaccacccacgagggc
gcacgtcacgttgacgacgttctgacccgccgcacccggatctccatcgaagcatgggac
cggggtgtgtctgccgcgcccgtagtagctaagctgatgggagaaatccttggctggagc
gagactcagcgcgagagcgaaatcaagcactacctggcgcgtgtggaagctgaacgactc
agtcagcagcaacccgatgacgaatcggctgatgccgcgcgcatgggagtggatgacatc
gttcccctgcgctga

DBGET integrated database retrieval system