KEGG   Arthrobacter sp. FB24: Arth_0294Help
Entry
Arth_0294         CDS       T00421                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module / ATP-dependent DNA ligase LigD ligase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
art  Arthrobacter sp. FB24
Pathway
art03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:art00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Arth_0294
Enzymes [BR:art01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Arth_0294
DNA repair and recombination proteins [BR:art03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Arth_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ABK01695
JGI: Arth0294
UniProt: A0JRM5
LinkDB All DBs
Position
complement(307939..310476)
Genome map
AA seq 845 aa AA seqDB search
MAGSRERVRIQGRELVVTNLDKVMYPETGTTKADVLAYYTAVAPVLVPAAVNRPATRKRW
VNGVGTAEAPGEMFFQKNLEDSTPGWIPRASIRHKERTNQYPLVNDAATLIWLAQMGSLE
IHVPQWRVDPHGNPMNPDRLVLDLDPGEGAGLAECAEVARLARAILRDVGLDPIPVTSGS
KGVHLYAGLDGTQSSDQISEFAHELARALESDHPDLAVSDMKKTLRTGKVLVDWSQNNAA
KTTIVPYSLRGRLRPTVAAPRTWRELASPKLKQLDYREVMRRVKDGKDPFAPVSAGGSHV
RGHPGGGGSAAGPRDSTTADGGSTDPRLEKYRSMRDPEGTPEPFSADRHGADPNAGTIRE
RFVIQEHHASRLHYDFRLERDGVLVSWALPKGVPTSGTQNHLAVQTEDHPMDYLDFEGTI
PKGQYGAGNVTIWDHGYYECDKWIAGKEVIATLTGADGGGLGGTRKFALIRTSRDSDTSK
SPEQAQWLIHLMDRKGHAPAATGTPPATGGPAEAAKQDEPPPDLSPAPDFLPMMASAGTP
ADLRGLDWQFELKWDGIRALIIGDADRIRLISRNGNDMTASYPELTDRSCWPEQSFTADG
EIVAVGPSGRPDFGLLQTRMKLTKAADVAKARAATPVRLMVFDLLSDAGEDLRRMPLRRR
RARLEQLDWPDGCPVHLSEVLDHEVEHILESARELGLEGIMAKRLDGRYVSGERSRSWLK
LKFERTQEVVVGGWRPGKGSRQGSVGSLLVGIPDGAKLRYVGRVGSGFSDRELKELRLQV
DTLSRKTSPFTEVPAADASDAHWVAPGLVGEVTFGEWTGGGKLRHPVWRGWRLDKNADDV
VAESG
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
ttggccggcagtagggaacgtgtccggatccagggccgcgaactggtggtcaccaacctg
gacaaggtgatgtacccggagaccggcaccaccaaggcggacgtcctggcgtactacacc
gccgtagcgccggttcttgtccccgccgcggtgaaccggcccgccacccgcaagcgctgg
gtcaacggggtgggcaccgcggaggcaccgggcgaaatgtttttccagaagaacctggag
gactccacgcccggctggattccgcgagcctcgatccggcacaaggagcgcaccaatcag
tacccgctggtcaacgacgccgccaccctgatctggctggcccagatgggttcgctggaa
atccacgtcccgcagtggcgcgtggacccgcacggcaatcccatgaacccggaccggctg
gtgctggaccttgaccccggcgagggcgccgggctggccgagtgcgccgaagtggcacgg
ttggcccgcgccatcctgagggacgttggcctggatcctatcccggtgaccagcggcagc
aagggcgtccacctctacgccggcctcgacggcacacagagctcggaccagatctccgag
ttcgcccacgaacttgcccgcgccctggaatcggaccacccggacctggctgtcagcgac
atgaagaagaccctccgcacaggcaaggttctggtggactggagccagaacaacgcggcg
aagaccactatcgtcccgtactcccttcgcggccggctccgccccactgtggcggccccc
aggacgtggcgtgagttggcctcccccaagctgaagcaactggactaccgggaggtcatg
cggcgggtcaaggacggcaaggatccgttcgcgccggtctccgcgggcggcagccacgtg
cggggccatcccggcggcgggggctccgccgccgggccccgcgacagtacaactgccgac
ggcggcagcacggacccgaggctggaaaagtaccgctccatgcgggatccggaagggacc
cccgaaccgttcagcgccgaccgtcacggggctgaccccaacgccggcaccatcagggag
cggtttgtgatccaggagcaccacgccagccggctgcattacgacttccggctggagcgg
gacggcgtgctggtgtcctgggcgcttccgaaaggcgtaccaacctcagggacgcagaac
caccttgcagtccagaccgaagaccaccccatggactacctcgatttcgagggcaccatc
cccaaaggccagtacggcgcagggaacgtcaccatctgggaccacggctactacgaatgc
gacaaatggatcgcaggcaaggaagtcatcgcaaccctcacgggggcggacggcggcggc
cttggcgggacccggaagttcgcactgatccggaccagccgggacagcgacacctcgaaa
tcgccggagcaggcccagtggctcatccatctgatggaccgcaaagggcacgcgccggca
gccacaggcactcccccggccacaggtggccccgcagaggcagcgaagcaggacgagccg
ccgccggacctctcgccggcgccggatttcctgccaatgatggccagcgccgggaccccg
gccgacctccgcggcttggactggcagttcgaactgaaatgggacggtatccgtgcgctc
atcatcggcgacgccgaccggatccggctcatcagccgtaacggcaatgacatgaccgca
agctacccggaactgacggaccgcagctgctggccggagcagagcttcaccgccgacggc
gagatcgtcgccgtcggaccttccgggcggcccgatttcgggctgctacagacgcggatg
aaactgaccaaagcggccgacgtcgccaaagcgcgggcagcgactccggtccggctcatg
gtgttcgacctgctgtccgacgcaggcgaggacctccgcaggatgcccctccggaggcgc
cgggcacgtttggagcagttggattggccggacggctgccccgtgcacctgtccgaagtc
ctggaccacgaggtggagcacatcctcgagagcgccagggaacttggcctcgaaggaatc
atggccaagcgccttgacggccgatatgtaagcggcgagcgcagcaggtcctggctgaag
ctgaagttcgagcgcacccaggaagtggtggtgggcggctggcgccccggcaaggggtcc
aggcaaggctccgtggggtcattgctggtgggcatccccgatggcgccaagctgcggtac
gtgggacgcgtgggcagcggattcagcgaccgggaactgaaggaactgcggctgcaggtg
gacacgctgtccaggaagacctcacccttcaccgaagttcccgctgccgacgcctccgat
gcccactgggtggctcccggactggtgggcgaagttaccttcggggaatggaccggcggc
gggaaactaaggcacccggtatggcgcggctggcgcctggacaagaacgccgacgacgtc
gtggcggaatccggatga

DBGET integrated database retrieval system