KEGG   Arthrobacter sp. FB24: Arth_4083Help
Entry
Arth_4083         CDS       T00421                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
art  Arthrobacter sp. FB24
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4607100..4608191)
Genome map
AA seq 363 aa AA seqDB search
MGVMQLPVMPPIAPMLAKAVSALPEVPDSGPKWSFEPKWDGFRSIIFRDGDEVEIGSRNG
KPMTRYFPELVEALKANLPPRCVLDGEIILVGASGDRLDFEALQQRIHPAASRVRLLAAQ
TPASFVAFDLLALDDEDLTGRPFSERRSMLEKALAGSAAPIHLTSTTRDNGTAQQWFHRF
EGAGLDGIVAKALDGSYQPDKRVMLKVKHERTADCVLAGYRVHTSGPDRIGSLLLGLYNG
DGQLASVGVVGAFPMQRRKDLFEELQPLVTGFDGHPWAWAKQEEGSRTPRNAEGSRWSAG
KDLSFIPLRPERVLEVKYDHMEGERFRHTAQFVRWRPDRDPASCTYEQLEEPVKYDLAEV
LAT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttatgcaactgccggtgatgcccccgatcgcgcccatgctcgccaaagccgtc
agcgccctgcccgaagtcccggattccggcccgaaatggagctttgaacccaagtgggac
ggcttccggtccatcatcttccgcgacggcgacgaggtggagatcggcagccgcaacggc
aagcccatgacccgctacttccccgaactcgtagaggcgctgaaggcgaacctgccgccc
cgctgcgttctggacggcgaaatcatcctggtgggtgcctccggtgaccggctggacttc
gaggcgctccagcagcggatccaccccgccgccagccgggtcaggctcctcgccgcccag
actccggccagctttgtggcgttcgacctgctggcgctcgacgacgaggacctcaccggc
cgcccgttctcggagcggcgcagcatgctggagaaggccctcgcgggcagtgccgcgccg
atccacctgacttccaccacccgggacaacggcacagcgcagcagtggttccacaggttc
gagggcgccggactcgacggcattgtggcgaaggcactggacggcagctaccagccggac
aaacgcgtgatgctcaaggtcaagcacgaacgcacggcggactgcgtcctggccggctac
cgcgtgcacaccagcggaccggaccggatcggttccctgctgctggggctctacaacggc
gacggccagctggccagcgtgggcgtggtgggcgccttccccatgcagcgccgcaaggac
ctgttcgaggaactccagcccctggtgactggcttcgacggccacccctgggcctgggcc
aagcaggaggaaggcagccggacgccgcggaacgccgagggcagccggtggagcgcgggc
aaggacctgtccttcatcccgctccggcccgagcgtgtgctggaagtgaaatacgaccac
atggagggcgaacggttccggcacacggcccagtttgtccgctggcgccccgaccgggac
cctgcctcctgcacctacgagcagctggaagagcccgtcaagtacgacctcgccgaggtg
ctggccacctag

DBGET integrated database retrieval system