KEGG   Arthrobacter sp. ATCC 21022: AUT26_01215Help
Entry
AUT26_01215       CDS       T04477                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
arz  Arthrobacter sp. ATCC 21022
Pathway
arz03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:arz00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AUT26_01215
Enzymes [BR:arz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AUT26_01215
DNA repair and recombination proteins [BR:arz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AUT26_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_primase_S Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AMB39004
UniProt: A0A0X4JT67
LinkDB All DBs
Position
complement(251679..254198)
Genome map
AA seq 839 aa AA seqDB search
MAGKQKERVVVEGHELTLTNLGKIIYPETGTTKAEVLAYYAAVAPYLIPAAANRPVTRKR
WVNGVGTAENPGEVFFQKNLEDSAPRWIPRVTIHHSDHANVYPMVNSLATLTWMAQIASL
EIHVPQWQVDPAGNPLRPDRFVLDLDPGPGAGLPECVEVARLARSILQDMGMEPVPVTSG
SKGIHLYTGLEGTLKSDQVSAFAHELARALEADHPALVVSDMKKSLRNGKVLVDWSQNSG
NKTTIVPYSLRGKAHPTVAAPRTWAELEDPDLDHLDYTEVMERVSTGEDFFAPISGRHLP
PHGENDDVGRPGSASSDANPGGREKLTVEGRLSKYVGMRDPGKTPEPFPSSSGPSVGDAS
RRSSEQPKPGDPAPPGGIFVIQEHHARRYHLDLRLERDGVLASWALPRGVPETPDRNNLA
VHTEDHPMEYADFAGVIPKGEYGAGTMTIWDRGEYTGEKWREGKEVIATLTGEPGGGLGG
TKRLALINTGDRWLIHLMKEQPGGRRAPKAAPEPPKPGPMQDYAPMLATSGTTDDLHGGD
WLYELKWDGIRAIITGTEGKIRLMSRNGNDLTATYPELTDRSCWPDGDFVADGEIVALGK
GSRPDFGLLQQRMNLVKAGDIERARASVPVQLMLFDLLYDDGADLTGLPFRGRRERLAAF
AERLTGGCPLHLSEVLDHDVDDLLHVASDLKLEGVMAKKAGSRYSPGRRSRAWIKLKLEQ
SQEVVVGGWRPGAGARSGTFGSLLLGVPRDGKLHYVGRVGTGFKDWQLKEIMGKLESRAA
EESPFLDIPREDAAGARWVEPELVAEVTFGEWTGPGRLRHPVWRGWRPDKSPEDVNQPN
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggaaagcagaaggagcgtgtcgtcgttgagggtcatgagctgaccctcacgaac
ctgggcaaaatcatctacccggagaccggcaccaccaaggccgaagtgctggcctactac
gccgcggttgccccctacctgatccccgcggcggccaaccggcccgtgacgcgcaagcgc
tgggtgaacggcgttggaacggcagaaaacccgggcgaggtcttcttccaaaagaacctg
gaagactcggcgcccaggtggattccgcgggtcaccatccaccattcggaccacgccaat
gtctaccccatggtcaacagcctcgccacgctgacgtggatggcgcagatcgcgtcattg
gaaatccacgtaccgcagtggcaggtggaccctgccggcaacccgttgcgccccgaccgc
tttgtcctcgacctcgatcccgggccgggcgcaggcctgcccgaatgcgttgaagttgcc
cggctggcccggtccatcctccaggacatgggcatggagccggtgccggtcaccagtggc
agcaagggcatccacctctacacgggcttggagggcacgctgaagtccgatcaggtctcc
gccttcgctcacgaacttgcccgggccttggaagcggaccacccggcgttggttgtgagt
gacatgaagaagtccctccgcaacggaaaagtcttggttgactggagccagaacagcggc
aacaagaccacgattgtcccgtactcgctgcgcggcaaggcgcaccccaccgtcgccgct
ccgaggacctgggcggagctcgaagacccggacctggaccacctcgactacaccgaagtg
atggaacgggtcagcactggcgaggacttcttcgcgccgatttccggccggcacctcccg
ccgcacggtgaaaacgacgacgtcggaaggccgggttccgcgtcatcggatgcgaacccg
ggtggtcgggagaagctgacggtggagggccgcctgtccaagtacgtaggaatgcgtgat
ccgggcaagaccccggaacctttcccgtcgtcgtccggtccttccgtaggcgacgcgtcc
cggaggtcgtccgaacagcccaagcccggagaccctgccccgcccggcggtatcttcgtc
atccaggaacaccacgcccggcgataccacttggacctgcgcctggagcgggacggagta
ctggcctcatgggcgctgccgcgcggcgtcccggaaacgccggaccggaacaaccttgcc
gtgcataccgaagaccaccccatggagtacgccgattttgcgggtgtcatccccaaaggc
gagtacggtgcagggaccatgaccatctgggaccgcggcgaatacacgggcgaaaaatgg
cgcgaaggcaaggaagtgatcgccaccctcacgggggaaccaggcggtggcttgggcgga
acaaagcggctcgccctcatcaacaccggcgaccgttggctcatccacctcatgaaggaa
cagcccggaggccgcagggcgccgaaagcggcaccagaaccacccaaacccggaccgatg
caggactatgcgccgatgctggcgacgtcgggcaccaccgatgatctgcacggaggtgac
tggctctacgaactcaaatgggatggcatccgcgccatcatcaccggaaccgaaggcaaa
atccggctgatgagccgcaacggcaacgacctcacggccacctaccctgagctgacggac
cggtcctgttggcccgacggcgacttcgtggcggacggcgaaatagttgccctcgggaag
ggttcgcggcccgacttcggcttgctccagcagcgcatgaacctcgtcaaagccggggac
attgagcgggcccgggcttcggttcccgtgcaactgatgcttttcgaccttttgtacgac
gacggcgcggacctcaccgggctgcccttccgcggccggagggagcggctcgcagccttt
gccgaacgcctgactggcggttgcccgcttcatttgtccgaggtactggaccatgatgtg
gacgacctcctgcatgtggcgtccgatctcaaactggaaggcgtgatggccaagaaggcc
gggagccgctactcccccgggcggcgcagccgggcgtggatcaagctgaagctcgaacag
agccaggaggtagtggttggcggctggcgtccgggcgccggagcccggagcggaacgttc
ggctcgctcctcctgggggtcccccgtgacgggaagctgcattacgtgggacgcgtgggc
accggcttcaaggactggcagctgaaggagatcatgggcaagctcgagtcccgtgctgcg
gaggaatcgcccttcctggatattccgcgcgaggatgccgcgggcgcacggtgggtggag
ccggagctggtggctgaggtgactttcggggagtggaccggcccgggccgtttgcggcat
ccggtgtggcggggttggcggccggacaagtctcctgaggacgtgaaccagcccaactga

DBGET integrated database retrieval system