KEGG   Arthrobacter sp. ATCC 21022: AUT26_02815Help
Entry
AUT26_02815       CDS       T04477                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
arz  Arthrobacter sp. ATCC 21022
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:arz00001]
  Lipid metabolism
   00600 Sphingolipid metabolism
    AUT26_02815
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AUT26_02815
Enzymes [BR:arz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AUT26_02815
Bacterial toxins [BR:arz02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AUT26_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
589196..592168
Genome map
AA seq 990 aa AA seqDB search
MRSNSTSAPSLVRRAATGVLTCAVSIGLLAGLGLPAQAAPTPPNSPTLPPGSFSETNLAA
DRTAANFFYRIPALTYLGNDVVLAAWDGRPGSAADAPNPNSIVQRRSTDGGKTWGPVQVI
AAGHVADASGPRYGYSDPSYIYDAEANKVFAFFVYSKDQGFGGSQFGNDDADRNVISSAV
IESSDAGVTWSQPRLITSVTKPGTSKTNPAAGDVRSNFASSGEGIQLKYGPHKGRLIQQY
AGDVRQADGSNKIQAYSVYSDDHGVTWHKGANVGDRMDENKTVELSDGRVLLNSRDNANR
GYRKVAVSTDGGATYGPVSQDTELPDPANNGAIARMFPNAAQGSADAKKLIFTNANSKTG
RENVSARVSCDDGETWPGVRTIRSGFSAYSTVTRLADGKFGVLYEGNYTDNMPFATFDDA
WLNYVCAPLAVPAVNIAPSATQEVPVTVTNQEATTLSGATATVYTPSGWSATTVPVPDVA
PGASVTVTVALTAPADASGPRSLNAAFTTADGRVSQFTFTATTPVAPQVGLTITGSAPAR
DVAANPYQAGDVLGYTLNVKSTANVAANSVPLTGTFDSGFLPPAAPNCRYNNLAAGASYN
CTTAKHTITAADMERGYFVPEATFSITSTTTPSLTKTVQFTGAAVALRDGLISADISGAR
TDVGRDLATRPYAAGELVPYAFTVKNTSPFVEQVVPTAGNFSPFLPAGAGNCRYLSLPAG
QSYECATPRHAVTAEEVEQGFFVPDTTWEVSAAGQSTRTYRINGGEVDLLVRDAALSATV
VAEWKDADGDRFASAGDPVTFTYTVGNAGNVALTGLEAPDAGISLPFLAPGDTATATREH
VLTAADVAGGSLAASAFEATARNGSKEVTATAEGQPLELKVQPAQPSKEPELTVQDLEDQ
TPPFDLGTAFKYRTGQKVSLAGLEYGQWYYVYLNKTGYRLGWMFPTTGDTVEFILPPEVR
NGRDDVVVLDKDGRRVSFDRLQVTPKGEKI
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
ttgagatccaacagcacctccgcaccatcgctagtccgaagagccgcaaccggcgtactg
acctgcgcggtcagcatcggcttgctggccggcttgggactgcccgcccaggcggccccc
actccgcccaattcgcccacgcttccaccgggcagcttctctgaaaccaatctggcggcc
gaccgcacggcggcgaatttcttctaccggattcccgcgcttacctaccttggcaacgac
gtggtccttgcagcgtgggacggtcgcccgggttcggcggcggacgccccgaacccgaac
tcgatcgtccagcgccgaagcacggacggtggcaagacctgggggccggtccaagtgatc
gccgcaggccacgtcgccgatgccagcggccctcgatacggctacagcgatccctcgtac
atctacgacgcggaagccaacaaggtcttcgctttcttcgtgtactcgaaggaccaaggc
tttggcggcagtcagttcggcaacgacgacgcggaccggaacgtcatttcctccgccgtc
atcgagtcttccgacgccggcgtgacatggagccagccccgcctcatcacctccgtcacc
aagccgggtaccagcaagaccaacccggcagccggcgacgtccgctccaactttgcctcc
tccggtgagggcatccagctcaaatacggcccgcacaagggccgtctcatccagcagtac
gccggcgacgtgcggcaagctgacggaagcaacaagatccaggcctacagcgtctattca
gacgatcacggcgtcacgtggcacaagggtgccaacgtgggcgaccggatggacgagaac
aagactgtggaactgtccgacggtcgggtcctgctcaactcccgggacaacgccaaccgg
ggctaccgcaaggtggccgtctccacggacggcggagccacgtacggccccgtcagccag
gacacggaattgccggaccctgccaacaacggtgcaatcgcccgcatgttccccaacgcg
gcgcagggctccgcagacgcgaagaaactgatcttcaccaacgcaaactccaagaccggc
cgcgaaaacgtctcggcccgggtctcctgtgacgacggcgaaacctggccgggcgtccgc
accatccgttccggcttctcggcctactcaacagtgacccgcctggcggacggaaagttc
ggcgtcctctacgagggcaactacacggacaacatgcccttcgccaccttcgacgacgcg
tggttgaactacgtctgcgctcccttggcagtaccggcagtcaacatcgccccgagcgca
acgcaggaggttccggtgaccgtcactaaccaggaagcaaccacgctttccggcgcgacc
gcaactgtctatacgccgtcggggtggtctgccaccacggtgcccgtgcccgacgtcgcc
cccggcgcgtccgtcaccgtgaccgttgcactgaccgcaccggcggacgccagtggcccg
cgcagcctcaacgcggcattcacgacggcggatggccgggtttcgcagttcaccttcacc
gccaccacgcccgtggctccgcaagtgggccttaccatcacgggctcggctccggcacgt
gacgtagcggccaacccgtaccaggccggtgacgtgctggggtacacgctcaacgtcaag
agcaccgcgaatgtggcggccaactccgtgccgttgaccggaacgttcgactccggcttc
ctgcctcccgcggcccccaactgccgctataacaaccttgcagccggagccagctacaac
tgcaccacggccaagcacaccatcacggccgccgatatggagaggggctactttgttccg
gaggccaccttcagcatcacttccacaacgacgccgtcactcaccaagacggtgcagttc
accggcgctgcggtcgccctgcgggatggcctgatttcggcggacatcagcggtgcgcgc
accgacgtcggacgcgacctcgcaacccggccgtacgcggcaggcgagctggttccctac
gcctttacggtcaagaacaccagcccgttcgttgagcaggtggttcctacagccggcaac
ttcagtccgttccttcctgccggggccggaaactgccgctacctgtccctcccggcaggc
cagagctatgagtgcgcgacgccccgtcacgcggtgacggctgaagaagtggagcagggc
ttctttgttcccgacaccacctgggaggtcagcgcagcgggccagagcaccaggacgtat
cggatcaatgggggagaagtggacctgttggtccgcgatgctgccttgtccgccacagtg
gtggccgaatggaaggatgctgacggagaccgcttcgccagcgccggagaccctgtaact
ttcacctacaccgtgggcaacgcgggcaatgtagcgttgacgggccttgaagcgcccgac
gccgggatatcgctgcccttccttgcccccggagacactgccacggcaacacgcgagcac
gtcctgaccgctgccgacgttgcaggtggatcgttggctgcctccgcttttgaggccacg
gcccgcaacggatccaaggaagtgaccgcaactgcggaaggtcagcccctggagctgaag
gtgcagccggcacagccaagcaaggagcccgaactgacagttcaggaccttgaggaccag
acgccgccgttcgatctcggcacggccttcaagtaccggaccggacagaaggtgtccctc
gccgggcttgagtacggtcagtggtattacgtgtacctcaataagacgggctaccgcctc
ggctggatgttccccaccaccggggacaccgtggagttcatcctcccgcccgaggtcagg
aatggccgggatgacgtggtggtgctggacaaggacggccgccgggtttccttcgaccgg
ctccaagtaacgccgaagggggagaagatctag

DBGET integrated database retrieval system