KEGG   Arthrobacter sp. ATCC 21022: AUT26_14175Help
Entry
AUT26_14175       CDS       T04477                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
arz  Arthrobacter sp. ATCC 21022
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:arz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AUT26_14175
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AUT26_14175
Enzymes [BR:arz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AUT26_14175
Peptidoglycan biosynthesis and degradation proteins [BR:arz01011]
 Precursor biosynthesis
  Racemase
   AUT26_14175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3137899..3139176)
Genome map
AA seq 425 aa AA seqDB search
MTYEAAADIGIGSKPSIAKTAVLERSAVIDLEAVRHNVRQFAGIASPANVMAVVKADAYG
HGAVQVARAALEAGATWLGVAHISEALALRAAGLDAPMLAWLHTRESNFQAAVAAGIDVG
VSGWELDAVVAAAREQERPARVHLKIDTGLGRNGCPIADWDQLVGQAMEYQDEGLLRVVG
IFSHLAVADEPQRPETDQQLAVFREAIAIAEDAGVDTEVRHIANTPATLSRPDSHFDLVR
VGLGIYGLSPFQGATSAELGLRPAMTVRALVSNCKTVPEGQGVSYGLNYHTAGRTTLGLI
PLGYADGVPRVATGGPIRVNGVTYPVVGRIAMDQMVIDFGPLTPEEAAKLKGAEAVMFGE
GTDDGPTADEWGRAAGTINYEIVTRISPRVPRTYVNESAAGPAAGAESAAGSVRPSEAAA
KAASL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgacttacgaagcagctgcagacatcggaatcgggtcgaaaccatcaatcgccaaaaca
gcggtgcttgagcgctccgccgtgatcgacctcgaagccgtgcggcacaacgttcgtcag
ttcgccggaatcgcttccccggccaacgtcatggccgtcgtgaaggccgatgcttacggg
cacggcgcggtgcaggttgcccgcgcagcactggaagcaggcgccacctggcttggggtt
gcccatatttccgaggcgttggccctgcgggcagccggcctcgatgcccccatgctggct
tggctgcacacgcgggaaagcaacttccaagccgcagtggccgccggcatcgacgtcggg
gtctccggttgggagctggacgcggtggtcgcggcggcccgtgagcaggaacgtcccgcc
agggtccacctaaagatcgataccggccttggccgcaacggctgccccatagccgactgg
gaccagttggtgggccaggccatggagtaccaggacgaagggctcttgcgcgtcgtgggc
atcttctcgcatctggccgtagccgatgaaccgcagcggccggagacggaccagcaactg
gccgtcttccgggaagcaatcgccattgccgaggacgccggcgtggatacggaagtccgc
cacatcgccaatactccggccaccctgtcacgtcccgattcacacttcgacctggtccgc
gtcgggctgggtatttacggactctcaccgttccaaggtgccacttccgccgagcttggc
ctccgcccggccatgacggtccgcgcccttgtttccaactgcaagacggtccctgagggc
caaggcgtgtcctacggactgaactaccacaccgccggccgtaccacgctgggcctcatc
cccctggggtacgcggacggtgttccgcgggtggccaccggcgggccgatccgcgtcaac
ggcgtcacgtacccggtggtgggcaggatcgccatggaccagatggtgatcgacttcggg
ccgctgacgcccgaggaagcagccaaactcaagggcgctgaggcggtcatgttcggtgaa
ggcaccgacgacggtcccaccgcggacgaatggggccgagccgcgggcaccatcaactat
gagatcgtgacccgcatcagcccccgcgttccgcgcacctacgtcaatgagtccgctgcc
gggccagcggccggggctgaatcagctgccggctcggtccggcccagtgaggcggcagct
aaggcagcctcgctgtga

DBGET integrated database retrieval system