KEGG   Acidilobus saccharovorans: ASAC_1185Help
Entry
ASAC_1185         CDS       T01283                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
asc  Acidilobus saccharovorans
Pathway
asc03030  DNA replication
asc03410  Base excision repair
asc03420  Nucleotide excision repair
asc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:asc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ASAC_1185
   03410 Base excision repair
    ASAC_1185
   03420 Nucleotide excision repair
    ASAC_1185
   03430 Mismatch repair
    ASAC_1185
Enzymes [BR:asc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ASAC_1185
    6.5.1.6  DNA ligase (ATP or NAD+)
     ASAC_1185
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ASAC_1185
DNA replication proteins [BR:asc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ASAC_1185
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ASAC_1185
DNA repair and recombination proteins [BR:asc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ASAC_1185
   NER (nucleotide excision repair)
    Other NER factors
     ASAC_1185
   MMR (mismatch exicision repair)
    Other MMR factors
     ASAC_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 CdAMP_rec
Motif
Other DBs
NCBI-ProteinID: ADL19590
UniProt: D9Q2Q2
LinkDB All DBs
Position
1177223..1179046
Genome map
AA seq 607 aa AA seqDB search
MLPSDMMFEDIANTFSSMEGITSRIQLTQLLAGLLKRTPADVIDKVVYMIQSKLGPDWKG
IPELGVGDKLLVQAIALAYGKSEGDVQKLVDKLGDPGKVAEQLAQTGGHLKSNLLTFMGG
GSSQLTVSRVFDSFMKIAYATGESSRDLKLKTLAGLLKDAKPIEARYIVRFVEGRLRLGI
GDATILDALAVAYGGSSAVRDLIERAYNLRADLGEIAKIVATQGVEALKGLKPEVGTPIR
PMLAERANDVKEILAKVGGKAYVEYKYDGERGQIHKDGDKIKIFSRRLEDITPMYPDIAD
GVREAIKAKKAIVEGEIVAIDPDTGELRPFQELMQRRRKYDIEKMMKEIPTRLFLFDIIM
KDDEDLTTRPLPYRRKVLESILEPNDRVVMSNYIASSDPDEIMNFFLQAIADGAEGVMIK
AIHDESVYRAGVRGWLWVKLKRDYRSEMSDTVDLVAVGAFYGKGKRGGKLGTLLLAAYDP
NNDVFKTVCKVGSGFTDEDINNMYDLFKPYIIDHRHPRVVSNLDADVWFEPVKVAEVIGA
ELTLSPAHTCCMDAVRKGAGISIRFPRFIRWRDDKGPEDATTEQELLEMYKRQLKKIEEK
PQPEGEA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgttgccctcagacatgatgttcgaggacatagctaacacgttcagctcaatggagggc
ataacttcaaggattcagctcacccagctcttggcaggcctgctgaagagaactcccgct
gacgttatagataaggtcgtttacatgatacagagcaaactgggccctgactggaagggc
atacccgagctaggggtaggcgataagctcctggtgcaggccatagctttggcttatggc
aagagcgagggcgacgtccagaagcttgtggacaagcttggggacccagggaaggtggcc
gagcagctggcccagaccggcggtcacctgaagagcaacctgctgacctttatggggggc
ggctcctcgcagctgaccgtcagcagagtcttcgactcattcatgaaaatagcctacgct
acgggggagagcagcagagaccttaaactgaagacgctggcgggtctcctgaaggacgcc
aaaccgatagaggcaagatatatagtcaggttcgttgagggcaggctaaggcttggcata
ggtgacgcgacaatactggacgcccttgcagtggcatacggaggctcctcggccgtgagg
gacttaatagaaagggcgtacaacctaagggctgacctgggggaaatagccaagatagtg
gcgacgcagggcgttgaggccctcaagggcctcaagccagaggttggcacgcctataagg
cctatgttggctgagagggctaacgatgttaaggagatactggctaaggtaggcggtaag
gcctatgttgagtataaatacgatggtgaaaggggccagatacataaggatggtgataag
ataaagatattctccagaaggcttgaggacataactcctatgtaccctgatatagctgat
ggcgtgagggaggccatcaaggccaagaaggcgatagttgaaggagagatagtagccata
gatccagacacgggtgagctcaggccattccaggagctgatgcagaggagaagaaagtat
gatatagagaagatgatgaaagaaataccgactaggttgttcctctttgacataataatg
aaggacgatgaggatctaactaccaggcccctgccctacaggaggaaggtcctcgagtca
atacttgaaccgaacgaccgggttgtcatgagcaattacatagcgagctccgaccctgac
gagataatgaacttcttccttcaggcaatagctgacggcgctgagggagttatgataaag
gctatacatgatgagagcgtctacagggcgggcgtgagaggctggctttgggttaagctg
aagcgcgactacaggagcgagatgtcggacactgtggacctagtcgctgttggagccttc
tatggtaagggcaagcgcggcggcaagcttggcacgctgctgttagccgcttatgatcct
aacaatgacgtctttaagacagtgtgcaaggtaggaagcggctttaccgatgaggatata
aataacatgtacgacctgttcaagccatatataatagaccacaggcatcccagggtagtg
tcaaaccttgacgctgacgtctggttcgagccggttaaggttgcagaggtaataggcgct
gagctcaccctctccccagctcacacgtgctgtatggacgccgtgaggaaaggagctggc
atctcaataaggttcccaaggtttataaggtggagggacgacaaaggtccagaggacgcc
acgaccgagcaagagctattggagatgtacaagaggcagttgaagaaaattgaagagaag
ccacagccggagggcgaggcctaa

DBGET integrated database retrieval system