KEGG   Alligator sinensis (Chinese alligator): 102372191Help
Entry
102372191         CDS       T02922                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 5-like
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102372191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 736 aa AA seqDB search
MATVGLKRPRFPLALGLQVGFTDFQCYRNNLQHQTAEMSTKHLVVRQGQPFTITLHFHGR
GYQPGVDTILLIVETGPNAEKSSGTRAVFPVARSGPTSSWRAVCARTSPSCVEITLSAPA
NAVIGRYLLKARVDSGTGQATSYQLGEFTLLFNAWSPADDVYLASETARQEYVVNDYGFI
YQGNKNWIHPCPWNYSQVEEGVVDICLRLLDRSLNFQHDPVEDCSLRNSPVYVSRVVSAM
INSNDDSGVLLGNWSEDYSGGICPSEWTGSVAILRQWDATGAQPVKYGQCWVFAAVMCTV
MRCLGVPTRVVTNTESGHEKDGNLVIDEYYNTMGHILATESKDSIWKFHVWNECWMARRD
LSPGYAGWQVLDATPQETSNGLYCCGPASVKAIKEGELHLSYDTPFVFSMVNVYRVVWLI
YGARKEKLLCDSRCVGNHISTKSIGRDERKDITDSYKYREGSQEERQVFAKALARAQHRK
AQGPSTAEPQASRFLPGLRASLDVSSPAECRGQEAPSKVHTCLRLKLAKSPEVGQDLGLV
LLAENLAFEHKDLKLSISTGSVLHDGAPLPPFWQNTLYIPFRPKEEKVIPWTISYAQYGR
HLSQDRLVRVSVVGEENSTWEKLLVERIITLAYHAILINVLSPIAANRPFALEVEITNPL
HEPARDCVLTMEGSGLLKEQFRLDMGVLRAQERSNITFQIIPFKTGQRQLQVNFKSNKVK
DIKGHTTLIVAPNIRF
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggccacagtgggactgaagagaccccgctttcccctggccctaggactgcaggttggg
ttcactgacttccagtgctatagaaacaacctgcaacaccaaacagcagagatgagcacc
aagcacctggtggtgcggcaggggcagcctttcaccatcaccttgcacttccacggccgg
ggctaccagcccggggtagacaccatcctgcttatcgtagagacagggccaaatgccgag
aaatcatcgggaacgcgagctgtattccctgtggctagatctggccccacaagcagctgg
agggcagtctgcgcgcgcaccagccccagctgcgtggaaatcacactgtctgctccagcc
aacgcagtcatcggccgctacctgctgaaggctcgtgttgactctggcacgggccaggcc
acctcctaccagctcggggaattcaccctgctcttcaacgcatggagcccagctgacgat
gtgtatctggcaagcgagacagcaaggcaggagtatgtagtgaatgactatggcttcata
taccagggaaacaagaactggatccatccatgtccctggaactattcgcaggtcgaggag
ggcgttgtggacatctgcctgaggctgctggacaggagcttaaacttccagcacgaccct
gtcgaggactgttccttacgcaacagccccgtctacgtcagccgggtggtgagcgcgatg
atcaacagcaatgatgacagcggggtcctgcttgggaactggagcgaagactactctggc
ggcatctgcccatccgagtggaccggcagtgtggccatcctgcggcagtgggacgccaca
ggagcccagccggtgaaatacgggcagtgctgggtcttcgcagcggtgatgtgcacagtg
atgagatgtctgggggtcccgacacgtgttgtaaccaacactgagtcaggccatgagaaa
gatggaaacctggtcatcgatgagtactacaataccatgggccacatccttgccacggag
agcaaggacagcatctggaagttccacgtctggaatgagtgctggatggcacggagggac
ctgtccccaggctacgccgggtggcaggtgctggatgcaacacctcaggaaaccagcaat
gggctctactgttgtggtcctgcctcagtcaaagccatcaaagaaggagaattgcacctt
tcctatgacactccctttgtgttctcaatggtgaatgtgtaccgcgttgtctggctgatc
tatggtgcaaggaaagagaaacttctctgcgattctcgctgtgttgggaaccacatcagc
accaagagcattgggagagatgagcgcaaggacatcactgacagctacaagtacagggaa
ggctcccaggaggaaaggcaggtgtttgcaaaggctcttgctagggctcagcacagaaag
gcacaagggcccagcacagcagagccccaggctagcaggtttctgccaggactgagggcc
tccctggacgtatccagcccagctgagtgccgtggccaggaggctccgagcaaggtgcac
acctgcctgaggttgaaactggccaagtcccctgaggttggccaggacctcggcctggtc
ctgctggctgagaatttggcttttgagcacaaggacttgaagctgagcatcagcaccggg
tctgtgctgcatgacggcgctcccctgcctccgttctggcagaacaccctgtacatccct
ttccgtcccaaagaagagaaggtcatcccatggacaatctcctacgcccagtatgggaga
cacctgtcccaagacaggctggtgcgagtgagcgttgttggggaggagaactccacctgg
gaaaagctgctggtggaaaggatcatcaccctggcttaccacgctatcctcatcaatgtc
ttgtcacccatagcggcgaaccgcccgtttgcccttgaggtcgagatcaccaaccctctg
cacgagccagccagggactgtgtcctgaccatggagggcagcggcctgctcaaggagcag
ttcagacttgacatgggagtcctcagagcccaggaaaggtccaacatcactttccaaatc
atccccttcaagacgggccaaaggcagctgcaagtcaacttcaagagcaacaaggtcaag
gacatcaaaggtcacacaactctcatagtagctccaaatataagattttaa

DBGET integrated database retrieval system