KEGG   Alligator sinensis (Chinese alligator): 102375051Help
Entry
102375051         CDS       T02922                                 

Gene name
HKDC1
Definition
(RefSeq) putative hexokinase HKDC1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102375051 (HKDC1)
   00051 Fructose and mannose metabolism
    102375051 (HKDC1)
   00052 Galactose metabolism
    102375051 (HKDC1)
   00500 Starch and sucrose metabolism
    102375051 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    102375051 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102375051 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102375051 (HKDC1)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102375051 (HKDC1)
Membrane trafficking [BR:asn04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102375051 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MFAVHLVAFYFTKLKEDQIKKVDRYLYHMRLSDDVLLDLMTRFQTEMVKGLGRDTNPTAA
VKMLPTFVRSIPDGSEKGDFLALDLGGSKFRVLKVKVSEDGKQNVQMESQFYPTPKEIIH
GNATELFDYVADCLEDFMENKNIKHKKLPIGFTFSFPCKQAKLDEGVLLSWTKHFKARGV
QETDVVSSLRNALRKHKDVHADVLALVNDTVGTMMTCGYDDQRCEVGVIIGTGTNACYME
EMSHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDLGSINPGKQLFEKMISGL
YLGELVRLILLKMAKEGLLFNGEIATALRTKGKIETKHVAAMEKYKEGLSNTKEILMELG
LFPSEEDCVAVQHVSTIVSFRSANLCAAALAAILTRLRENKKLMRLRTTVGMDGTLYKTH
PQYAKRLHKVVRRLVPNCDVRFLLSESGSGKGAAMVTAVAYRLASQRKQIDEILASFKLS
KENLREVKTKMRAELEYGLKKETQPNATVKMLPTYVCGTPDGTEKGKFLSLDLGGTNFRV
LLVKIRSGRRKSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLEYMGIKGARLPLGF
TFSFPCRQASIDKGTLVGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVG
TMMTCGYEDPNCEIGLIAGTGSNVCYMEDMKNIEVVEGNEGKMCINTEWGGFGDNGCIDN
IRTKYDKEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKHGLLFRGQISETLRTRG
IFETKFLSQIESDRLALLQVRRILQQLGLDSTCDDSIIVKEVCGAVSRRAAQLCGAGLAA
VVEKKRENRGVEHLKITVGVDGTLYKLHPHFSRILREMVKELAPQCDVTFMLSEDGSGKG
AALITAVAKRLHSIGEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgtacatttagttgccttttattttacaaaactaaaagaagatcagattaag
aaggtcgacaggtacctttatcacatgcgtctttctgatgatgtactacttgacttgatg
actcgcttccagacagagatggtgaagggccttggaagagacacaaacccgacagctgca
gtaaaaatgctgccaacatttgtacgatcaatacctgatggctcagaaaagggggatttt
cttgccctagatcttggtggatccaagtttcgagtcttaaaggtgaaagtgtctgaagat
gggaagcagaatgttcaaatggagagccagttctacccaaccccaaaggagatcatacat
gggaatgcgacagaactgtttgattatgtagctgactgtctggaagacttcatggaaaac
aaaaacataaaacataagaaattaccaattgggtttacattttcttttccctgcaaacaa
gctaagttagatgagggtgtgctgctttcttggacaaaacacttcaaggcacgaggagtt
caggagacggatgtggtcagttctctgcgcaacgccctcaggaaacataaggatgttcat
gcagatgttttggcactggtaaatgacacggtgggaactatgatgacctgtggatatgat
gatcagcgctgtgaagttggtgtcataattggaactggcaccaatgcctgctacatggaa
gaaatgagtcacattgatctggtggaaggtgatgaggggaggatgtgcattaacaccgag
tggggagcctttggagatgacgggtcattagaagacatcagaactgagtttgacagggaa
attgacttgggatctatcaatcctggaaaacagctgtttgagaagatgattagtggtttg
tatttaggagaacttgtaagactcatccttctaaaaatggcaaaggaaggattactcttc
aatggcgagatagccactgctctccgcaccaaaggcaagattgagacaaaacatgtagct
gctatggaaaaatacaaagaaggtctcagcaacactaaagagatcctaatggagctgggt
ctgtttccttctgaagaagattgtgttgctgttcagcatgtcagcaccattgtgtcattc
cgctcagcaaacctctgtgctgctgccttagcggcaatattgacacgtcttcgagaaaat
aaaaagctaatgagactgagaactactgttggcatggatggaactttgtataaaacacac
cctcaatatgccaaacgtctgcataaggttgtgaggagactggtcccaaattgtgacgtt
cgatttcttctctctgagagtggcagtgggaagggggcagcgatggtaacggcagttgca
tacagactagcatctcagcgtaagcaaattgatgagattctggcatcttttaaactctcc
aaggaaaatcttagagaagtgaaaactaaaatgagggcagaactagaatatggcctgaag
aaagaaacacaacccaatgccacagtgaaaatgttaccaacttatgtctgtggaacacca
gatgggacagaaaaaggaaaatttctttcacttgatcttggtggaacaaatttcagagtt
ctgcttgtgaaaattagaagtggaagaagaaaatctgtgaggatgtacaataaaatcttt
gccattcctctggaaatcatgcaaggaacaggagaagagctctttgatcacattgtccag
tgcatagcagattttttggagtacatgggaattaagggtgctcgacttcctttgggcttt
acgttctctttcccctgcaggcaagctagtattgataagggaacactagtggggtggaca
aaaggttttaaggcaacagactgtgaaggggaggatgttgttgacatgttaagagaagct
attaaacgaagaaatgagtttgacctggatattgtagcagtggtaaacgacaccgttggg
acaatgatgacatgtggctatgaggatccaaactgtgaaattggccttattgcaggaaca
ggcagcaatgtgtgttatatggaagatatgaagaatatagaagttgtggaagggaatgaa
ggaaaaatgtgtattaacacagagtggggaggttttggtgacaatgggtgcattgataat
atcagaacaaaatatgacaaagaagtggatgaaggttcattaaatcctgggaaacaaaga
tatgaaaaaatgaccagtggaatgtatttgggtgaaatagtgaggcaaattctgatcgac
ttaacaaagcatggacttctgtttagaggtcagatttcagagacgctcaggacaagagga
atatttgaaacaaaattcctgtctcagattgaaagtgaccggctagctcttcttcaggtc
agaagaattctgcagcaacttggactggacagcacttgtgacgacagcattattgtgaag
gaggtgtgtggtgctgtttcaaggagagcagcccaactctgtggggcaggactggctgcg
gtagtagagaagaagagagaaaacagaggtgtagagcacttgaaaatcactgttggagtg
gatgggactttatacaagttacatccacatttttctaggatcttacgggaaatggtgaaa
gagctggcacctcagtgtgacgtgacttttatgctgtctgaagatgggagtgggaaggga
gctgccctcattactgctgttgcaaaaagattgcatagtattggagaaaattaa

DBGET integrated database retrieval system