KEGG   Alligator sinensis (Chinese alligator): 102375112Help
Entry
102375112         CDS       T02922                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102375112 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 747 aa AA seqDB search
MPEPDTRYDVGRWASASLRTPPTMATQPPARPERRRRGVFSKVCACCRCCAGRNDDADWG
PAPGEVPGERRAEPVVREGMLVLNTVDLQSIRTGATRRAHHTNEYESDALIVRRGQPFTV
RLGFRQPYDPEEHRVCLEFLLGPTPQVAKGTHMLVPVGAAGTQGWQAEEVDSTGTTLTVR
VTSAPTAPIGCYRLGVKTRSPAGEYAAPFDPRHQVYLLFNPWCSRDSVYLDNDNLLEEYV
LNESGRIFYGTDAQIGERTWNYGQFDQGVLDACLYMLDRRGMPHAGRGDPINVSRVVSAM
VNSLDDNGVLIGNWTGDYSRGTNPSAWVGSVDILRQYHRSQQPVPYGQCWVFAGVTTSVL
RCLGIATRTVTNYNSAHDTDVSLTMDIYFDENMKPLEKLNADSVWNFHVWNDCWMKRPDL
PPGFDGWQVVDATPQETSSGIFCCGPCPVEAIKNGLVYLKYDAPFIFAEVNSDKVYWQRQ
ADGNFKIVYVEENAIGRLISTKAAGSHQRHDITHLYKHPEGSEAERKAVETAARYGTKAH
VYAGRSGGEDVVVSVEATEAVTGQDMHLSVALTNRSTGPRSVSLNLHVAITYYTGVAGPV
VKQERRQVELPPNGAQTVPLVVSYAEYQPHMVDQCAMKLSVSGKVAETGQVLAKQHNFRL
RTPDLTLTLVGPAIVGQETHVQIVFKNPLPQTLKGAVLHMEGAGLCSPKTITVGDIAGYQ
TVRLRQNFVPLRPGRRQLAASPGSPPL
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgccggagccagacacccgctatgatgtggggcgctgggccagcgccagcctgcgcacc
cctcccaccatggccacccagcctcctgcccggcctgagcgccggcgccgcggtgtcttc
agcaaggtgtgcgcctgctgccgctgctgtgctggccgcaatgatgatgctgactggggc
cctgcacccggcgaggtccctggggagcgccgtgccgaacccgtggtgagagagggcatg
ctggtgctgaacacggtggatctgcagagcatccgcacgggggccacgcgtcgcgcccac
cacacaaacgagtacgagtcggatgcactgattgtgcggcgggggcagcctttcaccgtg
cgcctcggcttccgccagccctacgaccctgaggagcaccgtgtctgcctagagttcctt
ctcggcccgacgccacaggtggctaagggcacccacatgctggtgccggtgggcgctgca
gggacgcagggctggcaggccgaggaggtggacagcacgggcaccactctcacagtgcgg
gtcacctcggcacccactgcccccattgggtgctacaggctgggcgtgaagacgcggagc
cctgcaggggagtacgctgcgcccttcgacccccgccaccaggtctacctgctcttcaac
ccctggtgctccagggactcggtgtacctagacaatgacaacttgctggaggagtacgtg
ctcaacgagagtgggcgcatcttctacggcactgacgcccagatcggcgagcgcacctgg
aactatgggcagtttgaccagggggtgctggacgcctgcctgtacatgctggaccggcgt
gggatgcctcatgcgggtcgcggggaccccatcaatgtctcccgcgtcgtgtccgccatg
gtgaactcactggatgacaatggggtgctgattggcaactggacgggcgactactcgcgt
ggcaccaacccatcggcctgggtgggcagtgtggacatcctgcggcagtaccaccgctct
caacagcctgtgccctatggccagtgctgggtcttcgccggcgtcaccaccagtgtactg
cggtgcctgggcatcgccacgcgcacagtgaccaactacaactccgcgcacgacacggac
gtcagcctcaccatggacatctactttgacgagaacatgaagccccttgagaagctcaac
gctgattcagtctggaacttccacgtgtggaacgactgctggatgaagcgccctgacctc
ccacctggctttgacgggtggcaggtggtggatgccaccccccaggagaccagcagtggg
attttctgctgtgggccctgccccgtggaagccatcaagaatgggctggtctacctgaag
tacgatgcccccttcatctttgccgaggtgaacagcgacaaggtatactggcagcgccag
gccgatggcaacttcaaaatcgtgtacgtggaggagaatgccatcgggcgcctcatcagc
accaaggccgcgggctcgcaccagcgccacgacatcacccacctctacaagcaccctgag
ggctcagaggcggagcgcaaggcggtggagacagcagcccgctatggcaccaaggcacac
gtgtatgcagggcgcagtggcggcgaggacgtggtggtgagcgtggaggccaccgaagca
gtgacgggacaggacatgcacctgagtgtggcactgaccaaccgcagcaccgggccccgc
tccgtcagcctcaacctgcacgtggccatcacctactacactggtgttgctgggcccgtc
gtcaagcaggagcgccgccaggtcgagctcccgcccaacggagcccagacagtgcccctg
gtggtgtcgtacgcggagtaccagccgcacatggtggaccagtgcgccatgaagctgagc
gtgtcagggaaggtggctgagaccgggcaggtgctggccaagcagcacaacttccgcctg
cgcacgcctgacctcaccctcacgctggtgggcccagccatagtggggcaggagacccat
gtccagatcgtcttcaagaacccgctgcctcagacgctgaagggggctgtcctccacatg
gagggtgccgggctgtgcagccccaagaccatcaccgtgggggacatcgccgggtaccag
acggtgcggctgcgccaaaacttcgtgcccctgcggcctgggcgccgccagctggcggcc
agcccgggcagccccccgctc

DBGET integrated database retrieval system