Alligator sinensis (Chinese alligator): 102377091 Help Entry 102377091         CDS       T02922                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04010   MAPK signaling pathway asn04020   Calcium signaling pathway asn04114   Oocyte meiosis asn04218   Cellular senescence asn04310   Wnt signaling pathway asn04370   VEGF signaling pathway asn04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:asn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102377091 (PPP3R1)    04310 Wnt signaling pathway     102377091 (PPP3R1)    04370 VEGF signaling pathway     102377091 (PPP3R1)    04020 Calcium signaling pathway     102377091 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102377091 (PPP3R1)    04218 Cellular senescence     102377091 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102377091 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:asn01009]     102377091 (PPP3R1) Protein phosphatases and associated proteins [BR:asn01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102377091 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 HTH_AsnC-type Motif Other DBs NCBI-GeneID:  102377091 NCBI-ProteinID:  XP_025057238 UniProt:  A0A3Q0GGE5 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEELGAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcgcactttgatgcggatgagattaaacgtctaggaaagagatttaagaagctt gatttggacaattctggctccttgagtgtagaagagttcatgtctttgcccgagttgcaa cagaatccattagtacagagagtaatagacatatttgacacagatgggaatggagaagtg gacttcaaagaatttatagaaggagtctcccagttcagtgtcaaaggggataaggagcag aagttgaggtttgctttccgcatttatgatatggacaaagatggctatatctccaatggg gaactcttccaggtgctgaagatgatggtggggaacaatctcaaagacactcagttacag caaattgtagacaaaaccataattaatgcagataaggatggtgatggaagaatatccttt gaagagctcggtgctgttgtaggaggcctagatatccacaaaaaaatggtggtagacgtg tga

DBGET integrated database retrieval system