KEGG   Alligator sinensis (Chinese alligator): 102378568Help
Entry
102378568         CDS       T02922                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102378568 (SETD1B)
Enzymes [BR:asn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102378568 (SETD1B)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102378568 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     102378568 (SETD1B)
    COMPASS/SET1 complex (yeast)
     102378568 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 102378568
NCBI-ProteinID: XP_006015257
UniProt: A0A1U7R0M6
LinkDB All DBs
Position
Un
AA seq 2024 aa AA seqDB search
MREGARLWRPAGDRPPHAMSFKEIQAGEKAAHPEDPGKKQSSSRSRGMENNAPAGASVEK
RNHHWRSYKLIIDPALKKGQHKLYRYDGQHFSMPNSGIAPVDCVRDPRIGRIWTKTKELE
LSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLTDMCKKYGEVEEVEILYNPKNKKHL
GIAKVIFATVKGAREAVQHLHNTSVMGNIIHVELDTKGETRMRFYGLLVSGLYTPQTLPV
GNEQDASPTVNENLQLTESLKRLKDSNLSSAGSSVTPNSSTPFSHDTAYSSCRQDTPNSY
SQYTPQSQGTPLTPRLGTPFSQDSTYSSRQTTPVYHYGQDSGYKPRRHDTKFTDAYNRRQ
GHHYVHNSAGVYRGSEHQFNTYKSHQPEPVQYSHTPSLSHSGSSSYKSAFSPYQAPAVFP
QSEEQQFPQTSRDAEYRRPAPPPAETAAEGSAATNVDFVPVKEKQEEPPPLPESNCVTEQ
STASFSQTPERSETPGTPTMESEMQHNSLDSRIEMLLKEQRTKLPFLNEHDSDNEIRMEG
SPISSSSSQLSPIPMYSSNSQPSYRGQTPSSRPSSTGLEDISPTPLPDSDDDEPILGAPA
LGQNSRATSEASMTPIDQLNRTSKPETSETKEMVPGDRSPASEKMDEGQHSSGEDMEISD
DEMNSAPITSAECAKTIVVNSSVNNSSVMAPSIPMPPPGFPPLPPPPPPQPGFPMPPPLP
PPPPPTHPAVTVPPPPLPAPPGVPPPHILPPLPPFHPGMFPVMQVDMISVLGNQWGGMPM
SFQMQTQMLSRMMQGQNTYQYPPFMGGRMQFVNLPPYRPFSMGAVIGRGQQWPPLPKFDP
SVPPPGYEPKKEDPHKATVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKER
LAKASLTPVKSGGEVEEKPKPKDRITSCLLENWNKGEGLGYEGIGLGIGLRGAIRLPSFK
VKRKEPPEAASAGDQKRIRPSTSIDDEDEESERDRDVPDVSSDLSKSNAEAVGVRRRPAR
PLELDSEGEEGDETSGKEEESSSEKEEEPEEAGGLVKAVPSKEEEEEEDEDADEEEEEEE
EDEEAGIEMNEKEEEPDSEEEDAASPSSSKAEVESSDESEDSSEFESSSDSDEDEEEDEE
EEEEDEEEEEDEVEEEAVAEDQDREGMMADTELQPATQEPPDEEKETILELYPVDDYMDA
TSLGLGEPALVEKPEEMEEIKPGENECSEVPEASIAAETLVDMEREQEEKLVPSPICVPV
GEPEPDAAPEPEALEGPKPESQGEEESVCPPTPAGAFGEPLPSKSSFFSKSDDSDVEARV
KVRVSSAAEEEDRLPRTPGREATVHSDPDTPILPAHKAPPSTLPLPSTPSKEDPLLPPER
FPEQLTVTKTPLEEDIPRTPGRDISAKSPHILAKSQSTDTIPVTPGSDGPLTGSSLALSS
PQVPGSPFSYPSQSPGINSGIPRTPGRDFNFTPTFSETGATIPCLLSGKKPSEDELDEKP
FKEPPSASLMVSVNSVPSPIPFASPPNADFHTDLELPPVEVVPGAALPCTPADGKISRED
GKAEVKSVLLSPEAPLIAAAILPPPPPPPSVLPPKRKPGRPKRSPPSVLSLDAYSGRPVD
PPPVPVALMESAVSKELLGGHPDAFYGLKVPEAVTLDFRNDGFHEKVPPEAVAEKLPFKE
LENQWNEDFKEEELHAKPKRQWRRQKKTPEDIPLIPSPEYSPPRPVFRPRSEFEEMTILY
DIWNGGIDEEDIKFMCITYDRLLQQDNGMDWLNDTLWVYHPPTSFSTPKKKKRDDGMREH
VTGCARSEGYYKIDKKDKLKYLNNSRAFAEEPPADTQGMSIPAQPHASTRAGSERRSEQR
RLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIR
QVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQ
KKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 6075 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaaggagctcgcctttggcggccggcaggcgatcggccaccccatgcaatgtct
ttcaaagagatccaggcaggagagaaagccgcgcaccctgaagacccaggcaaaaaacag
agttcaagtcggagccgcggcatggagaacaacgcaccagccggcgcttctgtcgagaag
aggaatcaccattggagaagttacaagttgattattgacccggctctgaaaaaaggacag
cacaaactctatcgttacgatgggcagcattttagcatgcctaactcgggaattgccccg
gtggattgtgtcagagatcccaggataggacggatatggaccaaaaccaaggagctggag
ctctctgttcccaaattcaagatcgacgagttctacgtggggccggtgccccccaagcag
gtcaccttcgccaagctgaatgacaacatccgtgaaaacttcctgaccgacatgtgcaag
aaatacggggaggtggaagaggtggagatcctctacaaccccaagaacaagaagcacctg
ggcattgccaaagtgatctttgccaccgtcaagggggcgcgagaagccgtccagcacctg
cacaacacctcggtcatgggcaacatcatccacgtggagctggacaccaaaggtgaaacc
cgcatgcggttctatggcttgctggtgagcggtctttacactcctcagacccttcccgta
ggcaacgaacaggatgcctcgcccacggtgaatgaaaatctgcagctgacggagtctcta
aaacgcctgaaagacagtaacctttcttctgcgggatcatccgtcaccccaaacagtagc
accccgttttcccatgacacagcctattccagctgtcggcaagacaccccaaactcatac
agccaatataccccccagtcccaaggcaccccccttaccccgcggctggggactccgttt
tcccaagactcaacctattccagtcgtcagacgacaccggtgtaccattacggacaggac
tctgggtataaacccaggagacacgacacaaaatttacagatgcctacaatagacggcaa
ggacatcactatgtccataactcggcaggtgtttacagagggtcggagcatcagtttaac
acatacaaatctcatcagccagagccagtacaatattctcacactccttccttgagccat
tctggctcttcgagttacaaatctgccttctctccgtaccaagcgccagctgtatttcct
cagtccgaggagcagcagtttccccagacttccagagatgctgagtaccgaagacccgcg
ccaccgccggctgagacggcggcggaaggtagcgctgctaccaacgttgattttgtccct
gtgaaagagaagcaggaggaacccccgcccctgccagaatccaactgtgttactgagcaa
agcacggcgtccttctctcagactccagaacggagcgagacgcctggcacccccaccatg
gagtctgaaatgcagcataacagtttagactcaaggatcgagatgctcttgaaggagcag
agaacaaagttacctttcctcaacgaacacgactcggacaatgagatccgcatggaaggc
agccccatctcttcctcctcctcccagctctccccaatccccatgtatagttccaactcc
cagcccagttaccgaggtcagacaccatcctcgcgcccctccagcactggcttggaggat
attagtcccacgccattaccagactccgatgacgatgagcccatccttggggcacctgct
ctgggccagaattcaagggcaacatcagaggccagtatgactcctatcgatcagctgaat
aggacgtccaaacctgagacctctgaaaccaaggaaatggtgcctggtgaccggagtcca
gcgtcagaaaaaatggatgagggtcagcattcgtcaggggaggacatggaaatatccgac
gacgaaatgaattctgcaccgatcaccagtgcagagtgtgccaaaaccatcgtggtgaac
tcctcggtcaacaactcgtctgtgatggctccctcgatacccatgcccccgccggggttc
ccgcctcttccgcccccgcccccgccccagccaggcttccccatgccaccgcctctgcca
ccgccgcctccacccactcacccggcggtcaccgtccctccacctcctctccccgcaccg
cctggggtccccccaccccacatcttgcctccccttcctccgttccacccgggcatgttt
cccgtcatgcaggtggatatgataagcgtcttgggcaaccagtggggtggcatgcccatg
tcctttcagatgcaaactcagatgctgagccggatgatgcagggccagaacacctaccag
tacccaccgttcatggggggccggatgcagtttgtgaatcttcctccctaccgccccttc
tccatgggggcagtcattggccgcgggcagcagtggcccccgttgcccaagtttgacccc
tccgttcccccgccgggttacgagccaaagaaggaagacccgcacaaagctaccgtggac
ggcgtcctcttggtgattgtgaaagaactgaaagcaatcatgaaaagggacttgaaccgc
aagatggtcgaggtggtggcgttcagggcgttcgacgactggtgggacaagaaagaacgt
ctggcaaaggcatcgctcactccagtgaagtcgggaggagaagtggaggagaaaccaaag
ccgaaggatcggatcacgtcctgtctcttggagaactggaacaaaggagaagggctgggc
tacgagggaattggcctgggcattgggttgcgaggagccatccgcctgccgtctttcaag
gtgaagagaaaggagccgcccgaagctgcctcagcaggggaccagaagaggatcagaccc
tccacttccattgacgatgaagatgaagaatctgaaagggacagagacgtgcccgacgtg
tcttccgacctgtccaagagcaacgcggaagcggtaggcgttaggcggcggccagcaaga
ccactggagctggacagcgagggggaggaaggcgatgagacttcgggcaaagaagaagaa
tcctcatcagaaaaggaagaggagccggaggaagcgggaggactggtgaaagcagtgcct
agcaaggaggaggaggaggaagaggatgaagatgctgatgaagaggaggaggaggaggag
gaggatgaagaagcaggcatagaaatgaatgaaaaggaagaggagccagactctgaggaa
gaagatgcagcgagtccctcatcctccaaagcggaagtcgagtcatccgacgaaagcgag
gactcctcggaatttgagtccagttctgattctgatgaagacgaggaggaagatgaggag
gaggaggaggaagatgaggaggaggaggaagatgaggtggaagaggaggcagtggctgaa
gaccaagacagagaaggcatgatggctgacaccgagcttcagcctgccactcaagagcca
cccgatgaagaaaaagagaccatcctggagctgtatccggtggatgactacatggatgca
accagcctgggactcggggaaccagccctggtcgaaaaaccagaagaaatggaagaaatc
aagccaggagaaaatgagtgtagtgaagtgccggaagcatctattgctgctgaaactctg
gtggatatggagcgagagcaggaggaaaagctcgtgccgtccccgatctgcgtgccagtg
ggggagcctgagccagacgctgcgccagagcccgaagcactcgagggtccaaagcctgaa
tctcaaggtgaagaagagagcgtctgtcccccgacaccagcgggagcgtttggagagccc
ctgcccagcaagagcagcttcttcagcaagtccgacgacagtgatgtagaagcgcgagtt
aaggtgagagtttcctctgcagcagaggaagaggacagactgcctcggactcctggacgg
gaggcgacggtccattcggatcctgatactcccatacttcccgctcataaggcgccaccc
tctacgcttcccctgccatccacgcccagcaaagaggatcctttgctccctccagagagg
ttcccagaacagctaactgtgaccaaaacacccctggaagaggatatccccaggacaccc
gggcgggacatttcagccaagtctccgcacatccttgcaaagtcgcagagtactgacact
attccagtcacccccggaagcgacggtccgctcacagggagcagcctggccttaagttcc
ccccaggtcccagggagccccttttcctacccatcccagtctcctgggatcaacagtggc
attcctcgaactcccgggagggattttaacttcacacccacgttctccgagaccggtgct
accattccttgcctgttgtctggcaagaagccatccgaggatgagctagatgagaaacct
ttcaaagaacctcctagtgcttccttaatggtcagcgtgaacagtgtcccttcccccatt
ccctttgccagccctcccaatgcagatttccacacagacctagagttgccacccgtcgag
gtggtgccgggggcagctctgccatgcacgccagcagacgggaagatatccagagaggac
ggcaaggcagaagtgaaatcggttttgctctcgccggaagcacctctcattgctgctgct
attcttcctccccctcctcctcctccttccgttctgccccccaaaaggaaaccgggtcgg
ccgaaacgatcgcccccctctgtcctttcgctggatgcctattctggcagacccgtggat
cctcctcctgtcccagtggccttgatggaaagtgccgtgagcaaagagctgctgggcgga
catcccgatgctttttatgggttgaaagttcctgaagcagtcaccctggacttcaggaat
gacggcttccacgagaaggtgcccccggaggccgtagccgagaaactcccgtttaaggaa
ctggagaaccagtggaacgaggatttcaaagaagaagagcttcacgcgaaacctaaaaga
cagtggcgaaggcagaagaagacacctgaggacatcccacttattccttccccggagtat
tccccaccccggcctgtcttcaggccccgctccgagtttgaggagatgaccattttgtac
gatatttggaacgggggaatagacgaagaagacatcaagttcatgtgcatcacgtacgac
cgcttgttgcagcaagataatggtatggactggctcaacgataccctgtgggtataccac
cctcctaccagcttttccaccccgaagaagaagaagcgggacgatgggatgcgggagcac
gttaccggctgtgcacgaagcgaaggctattacaaaatcgataagaaggacaaacttaaa
tacctcaacaacagccgcgcgttcgcagaggagccgccagctgatacgcagggaatgagc
atccctgctcagcctcatgcttccacccgggctggctccgagaggaggtcggagcagcgc
aggcttctctcgtctttcaccgggagctgtgacagcgacctactcaaatttaaccagctc
aagttccggaagaaaaaactaaaattctgcaagagccacattcacgactggggacttttt
gctatggagcccatcgcagccgatgagatggtgattgaatacgtgggccagaacatcaga
caggtcattgctgacatgcgagagaaacgatatgaagatgaaggcattgggagcagctac
atgttcagggtcgaccatgacaccatcatcgatgccacaaaatgtggaaactttgccagg
tttattaatcacagctgcaatccaaattgctacgctaaagtcatcaccgtggagtcccag
aagaagattgtcatctactcgaagcagcacatcaacgtgaacgaggaaattacctacgac
tacaagtttccgatcgaggacgtaaaaatcccatgtttgtgtggctctgagaactgcaga
gggaccctgaactag

DBGET integrated database retrieval system