KEGG   Alteromonas stellipolaris LMG 21861: AVL57_16575Help
Entry
AVL57_16575       CDS       T04545                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
asq  Alteromonas stellipolaris LMG 21861
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:asq00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AVL57_16575
Enzymes [BR:asq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AVL57_16575
Transporters [BR:asq02000]
 Other Transporters
  Pores ion channels [TC:1]
   AVL57_16575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3590252..3590890)
Genome map
AA seq 212 aa AA seqDB search
MYTLYGYPKTRSVRVAWALEEIGLPYEYKVVNLKAGEHLNSAFKTLNPATKIPVLVTEEG
ALSESAAIVTFLAEKHAMEEFIPAPGTFARGLYEQMMVFAVTELEQPLWSKAKHTFALPE
QHRIPQMQDTAAWEFDRALTAFSLLLNDKEYVCGSLFTMADIVTAQVLSWAKGSDLDLKF
DNVKSYAERVLSRPAYEKAWRNEMAHLSKTDT
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactttatggatacccgaaaactcgctcggtaagggtggcatgggctttagaa
gaaattggcttgccttacgagtacaaggtggtgaatttaaaagccggtgaacacttaaac
tcagcttttaaaacacttaacccggccactaaaattcctgtattagtcactgaagaaggt
gcgctttctgagtcggctgctattgtcactttcttagctgaaaagcatgcaatggaagag
tttatacctgcacccggtactttcgctcgcgggctgtatgagcaaatgatggtatttgct
gttactgagttagaacagccgctttggagtaaagctaaacatacctttgctttacctgag
cagcatcgtattccccaaatgcaagatacagcggcgtgggaattcgaccgagcattaacg
gctttctcgctacttctcaacgacaaagagtatgtctgcggaagcttattcacaatggct
gacattgtgacagcccaagtattgtcatgggctaaaggtagcgaccttgaccttaagttc
gacaatgtgaaatcgtacgctgaaagagtgctatctcggcctgcttatgaaaaagcatgg
cgcaacgagatggcacatttgtctaagactgatacttaa

DBGET integrated database retrieval system