KEGG   Aeromonas schubertii: WL1483_1407Help
Entry
WL1483_1407       CDS       T04186                                 

Gene name
davT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
asr  Aeromonas schubertii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:asr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    WL1483_1407 (davT)
   00650 Butanoate metabolism
    WL1483_1407 (davT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WL1483_1407 (davT)
   00280 Valine, leucine and isoleucine degradation
    WL1483_1407 (davT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WL1483_1407 (davT)
Enzymes [BR:asr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WL1483_1407 (davT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     WL1483_1407 (davT)
Amino acid related enzymes [BR:asr01007]
 Aminotransferase (transaminase)
  Class III
   WL1483_1407 (davT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(986778..988076)
Genome map
AA seq 432 aa AA seqDB search
MSQSSNQQWQARREAAVVQGVGTLLPAFIERASNAELWDVEGKRYIDFASGIAVLNTGHN
HPKVIAAVRDQLEKFSHTCFQVTPYPGYIELAERLNALVPGPTPKRTLFLSTGAEAVENA
IKIARAHTGRSGVIAFKGGFHGRTMMGMALTGKVVPYKVGFGPFPGEVYHLPFPADYLGV
SEESALAALEGLFAADIEPARVAAIIIEPVQGEGGFYPASPSFLQALRRVCDQHGILLIC
DEIQTGFCRTGKTFATEYSGIEPDIMTLAKSLAGGFPLSAVVGKSEVMNAAKPGGLGGTY
AGSPIACAAALAVLDVLEEVLEEEQLNQKAQAQGELIKSRLHRIGERFDCIGQIRGPGAM
VAMELVKNGDAGQPDPDLTKRLVAEAGKRGLILLSCGVRANVIRFLAPLTAPVALLEEGL
AILEQSLEAALA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcgagcaaccaacagtggcaggcccgccgtgaggccgccgtggttcagggc
gtgggcaccctgctgcccgcctttatcgagcgcgccagcaacgcagagctgtgggatgtg
gagggcaagcgctatatcgacttcgcctccggcatcgccgtgctcaacacgggccacaac
catcccaaggtgatcgccgcggtgcgcgatcagctggagaaattcagtcacacctgcttc
caggtcaccccctacccgggctacatcgagcttgccgagcggctcaatgccctggtaccc
ggccccacccccaagcgcaccctgtttctctcgaccggggccgaggcggtggagaacgcc
atcaagatagcccgcgcccacaccggacgcagcggcgttatcgccttcaaggggggcttt
cacggtcgcaccatgatgggcatggccctcaccggcaaggtggttccctacaaggtgggc
tttggccccttccccggtgaggtctaccacctccccttcccggccgactatctgggggtg
agcgaggagagtgccctcgccgccctggaggggctcttcgccgccgacatcgagccggcc
cgggtcgccgccatcatcatagagccggtacagggtgaagggggcttctaccccgcctcc
ccaagcttcctgcaggccctgcgccgggtctgcgaccagcacggcatcctgcttatttgc
gacgaaatacaaaccggcttctgccgcactggcaagaccttcgccaccgagtacagcggc
atagagccggacatcatgaccctggccaagagcctggccgggggcttccccctctcggcc
gtggtgggcaagagcgaggtgatgaacgccgccaagccgggcggtctcggcggcacctat
gccggctcccccatcgcctgcgccgccgccctggcggtactcgatgtgctcgaggaggtg
ctcgaggaggagcagctcaaccagaaggcccaggcccagggcgagctgatcaagagccgg
ctgcatcgcataggcgagcgttttgactgcataggtcaaattcgtggccccggcgccatg
gtggccatggagctggtgaaaaacggggatgccggccagccggatcccgatcttaccaag
cgcctggtggccgaggcgggcaagcgcggtcttatcctgctctcatgcggggttcgcgcg
aatgttatccgtttcctggcccccctgacggcccctgtcgcactgctggaagaggggctg
gccatcctggagcaatccctggaggccgcgctggcctga

DBGET integrated database retrieval system