KEGG   Actinobacillus suis ATCC 33415: ASU1_08755Help
Entry
ASU1_08755        CDS       T03246                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ass  Actinobacillus suis ATCC 33415
Brite
Translation factors [BR:ass03012]
 Eukaryotic Type
  Elongation factors
   ASU1_08755
 Prokaryotic Type
   ASU1_08755
Mitochondrial biogenesis [BR:ass03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ASU1_08755
Exosome [BR:ass04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ASU1_08755
  Exosomal proteins of breast cancer cells
   ASU1_08755
  Exosomal proteins of colorectal cancer cells
   ASU1_08755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1940972..1942156)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHFGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKSG
EEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENVGALLRGTKREEIERGQVLAKPGTIT
PHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDEGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtgggtacaatcggccac
gttgaccatggtaaaacaactttaacagcagcgatcacaactgtattagcgaaacacttc
ggtggtgcagctcgtgcattcgaccaaatcgataacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacttcacacgttgagtacgatacagaaacacgtcactacgcacacgta
gactgcccgggacacgcggactatgttaaaaacatgattactggtgcggcgcaaatggac
ggtgcaatcttagtagtagcagcgacagacggtccaatgccacaaactcgtgagcacatc
ttattaggtcgccaagtaggtgtaccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgtgaacttctttctcaa
tacgacttcccaggtgatgatacaccaatcgtacgtggttcagcgttacaagcgttaaac
ggcgtagcagagtgggaagaaaaaattcttgagttagcgaaccacttagatacatacatt
ccagagccagagcgtgcgattgataaaccattcttattaccaatcgaagacgtattctca
atctcaggtcgtggtacagtagtaacaggtcgtgtagagcgcggtatcatcaaatcaggt
gaagaagttgaaatcgtaggtatcaaagaaactacaaaaacaacagtaactggtgttgag
atgttccgtaaattattagacgaaggtcgtgcgggtgaaaacgttggtgcattattacgt
ggtacaaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggtacaatcaca
ccacacacagacttcgaatcagaagtttacgtattatcaaaagaagaaggtggtcgtcat
actccattcttcaaaggttaccgtccacagttctacttccgtacaacagacgtaacaggt
acaatcgaattacctgaaggcgtagagatggtaatgccaggcgacaacatcaaaatgact
gttagcttaattcacccaatcgcgatggacgaaggtttacgttttgcgattcgtgaaggt
ggccgtacagtaggtgcaggtgttgtagcgaaaatcatcaaataa

DBGET integrated database retrieval system