KEGG   Agrobacterium tumefaciens S33: AWN88_24985Help
Entry
AWN88_24985       CDS       T04213                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ata00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AWN88_24985
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AWN88_24985
Enzymes [BR:ata01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AWN88_24985
Peptidoglycan biosynthesis and degradation proteins [BR:ata01011]
 Precursor biosynthesis
  Racemase
   AWN88_24985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
linear:complement(2841743..2842918)
Genome map
AA seq 391 aa AA seqDB search
MTDDFEDTFAETETDAFEQAPLRLTVDLGALADNWRDMRRRSGKARTAAVVKADAYGLGI
EDCGAALYHAGARDFFVATVAEGETLRSYAPEARIFVLSGIWQGQERQVFDNDLVPVLAS
EEQLSFWMATVAERGDHPCALHVDTGFNRLGLPLDDALFLADDVTRPASFDPVLVLSHLA
CADTPSSPMNRAQLESFRTVSTAFEGIESSLSASAGIFLGPDYHFDLTRPGISLYGGEAV
NDVANPMRPVAKAEARIIQIRDAGEGQTVSYGGTFLLKRASRLAIATVGYADGYQRSLSG
SGIPLREMGHGGAYGVVNGHKVPVAGRVTMDLTIFDVTDVPANAIRTGDYVELFGPSVPV
DETARAAGTIGYEMLTGLGLRYERQYLMADD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgacttcgaggatacattcgctgaaaccgaaaccgacgctttcgaacaagcg
ccactgcggctgaccgtcgatctcggtgcgctggccgataattggcgggacatgaggaga
cgctccggcaaggcgcggacagcggccgtcgtgaaggccgatgcctatggcctcggcatc
gaggattgcggcgcagcgctctaccatgccggcgcgcgcgacttcttcgtggcaacggtt
gccgagggtgagaccctgcgttcctatgcacctgaagcacgcatcttcgtcctgtcaggc
atctggcagggccaggaacggcaggtcttcgacaatgatctggtgccggttctcgcctcc
gaggagcaactttccttctggatggcgacggtggccgagcgtggcgatcacccctgcgca
ctgcatgtggacaccggcttcaaccgtctcggactgccgctcgacgatgcgctgtttctg
gccgacgacgtgacccggccggcaagttttgacccggttctggtgctgtcccatctcgcc
tgtgccgacacgccctcctcgccgatgaacagggcgcagctcgaatcattccggacggtt
agcactgctttcgaaggtatcgaatcaagcctctcggcttccgccggtatctttctcggc
ccggattatcatttcgaccttacccgtcccggcatatcgctctatggcggagaggcggtc
aacgacgttgcaaatcccatgcggccggtcgccaaagccgaagcgcgcatcatccagatc
cgcgatgcgggcgaaggccagaccgtcagttatggcggcacctttctgctgaaacgcgca
agccgcctcgccatcgcgactgtcggttacgcggacggataccagcgttcgctgtccggt
tccggcattccgctgcgcgaaatgggccatggcggcgcatacggtgtcgtcaacggccac
aaggtgccggttgctggccgcgtcaccatggacctcaccatcttcgacgtgacggatgtt
ccggccaatgccattcgaaccggagactatgtcgagcttttcggtcccagtgtgcccgta
gacgagactgcacgggcggcaggaacgatcggctatgagatgttgacaggacttggtctg
cgatatgagcggcaatatctgatggcggatgattga

DBGET integrated database retrieval system