KEGG   Caldicellulosiruptor bescii: Athe_0810Help
Entry
Athe_0810         CDS       T00857                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ate  Caldicellulosiruptor bescii
Brite
Translation factors [BR:ate03012]
 Eukaryotic Type
  Elongation factors
   Athe_0810
 Prokaryotic Type
   Athe_0810
Mitochondrial biogenesis [BR:ate03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Athe_0810
Exosome [BR:ate04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Athe_0810
  Exosomal proteins of breast cancer cells
   Athe_0810
  Exosomal proteins of colorectal cancer cells
   Athe_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
906467..907669
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLALKGKAQFMAYDQIDKAPEERERG
ITINTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVNVPYIVVFLNKVDMVDDPELIELVEMEVRELLSKYGYPGDEVPIVKGSALKALE
STSQDPNAPEYQCILELMDAVDKYIPTPQRDIDKPFLMPIEDVFSITGRGTVVTGRVERG
TLKTGEEVEIVGFAPEPRKTVVTGIEMFRKVLDEAVAGDNVGCLLRGIQKNEVERGQVLA
KPGTIKPHTKFKAQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGTITLPEGVEMCMPG
DNVEMTVELISPIAIESGLRFAIREGGRTVGAGSVTTIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggctaaatttgaaagaacaaaaccacacgtaaacataggtacaattggacac
gttgaccatgggaaaacaacattgacagctgcaattacaaaggttttagctctcaaaggt
aaagcacagtttatggcttatgaccagattgacaaggctccagaggaaagagaaagaggt
attacaatcaacacagcacacgttgagtatgagacagatgcaagacactatgcacacgtt
gactgtccaggtcacgctgactacgttaagaacatgataacaggtgctgctcaaatggat
ggtgcaatcttagtagtttctgcagcagacggtccaatgccacagacaagagagcacatt
ttgcttgcgcgacaggttaacgttccatacatcgttgtattcctcaataaggttgacatg
gtagatgatccagaattgattgaattggtagaaatggaagtaagagaacttctttctaag
tatggctatccaggagatgaagtaccaatagtaaaaggttcagctttgaaggctttagag
tcaacatcacaagatccaaatgctccagaatatcagtgcatcttagagctcatggatgct
gttgacaaatacatcccaacaccacagagagacattgacaaaccattcttgatgccaatt
gaagacgtgttctcaatcacaggtagaggtactgttgtaacgggtagagttgaaagagga
acactcaagacaggagaagaggttgaaattgtaggttttgctccagagccaagaaagaca
gttgttacaggtattgagatgttcagaaaagtattggacgaggctgttgctggtgacaat
gtagggtgccttctcagaggtattcagaagaatgaggttgaaagaggtcaggttcttgca
aagccaggcacaattaaacctcatacaaagttcaaagcacaggtttacgttttgacaaaa
gaagagggaggaagacatacaccattcttcaatggttacagaccacagttttatttcaga
acaacagacgttacaggaacaatcacactaccagagggtgtagagatgtgtatgcctggc
gacaacgttgagatgacagttgaacttatctctccaattgctattgagtcaggactcaga
tttgctatccgcgaaggcggaagaacagttggtgcaggttctgttacaacaataattgaa
taa

DBGET integrated database retrieval system