KEGG   Arabidopsis thaliana (thale cress): AT1G02940Help
Entry
AT1G02940         CDS       T00041                                 

Gene name
GSTF5
Definition
(RefSeq) glutathione S-transferase (class phi) 5
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT1G02940 (GSTF5)
Enzymes [BR:ath01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AT1G02940 (GSTF5)
Transporters [BR:ath02000]
 Other Transporters
  Pores ion channels [TC:1]
   AT1G02940 (GSTF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 256 aa AA seqDB search
MGINASHVPETCYHHCNQTFESSRQCFKWCQELARKDEYKIYGYPYSTNTRRVLAVLHEK
GLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRAISEYIATVHKSRGTQ
LLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMYGLKTDYKVVNETEAKLEKV
LDIYEERLKNSSFLASNSFTMADLYHLPNIQYLMDTHTKRMFVNRPSVRRWVAEITARPA
WKRACDVKAWYHKKKN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgggcataaacgcgagccatgtaccggaaacttgctaccatcattgtaaccagacgttc
gagagtagtcgccaatgctttaaatggtgtcaagaattagctcgtaaagatgagtacaag
atttatgggtacccttactcaaccaacacaaggcgtgtcctcgccgttcttcatgagaaa
ggtctctcttacgatcccatcaccgtcaacttgatagccggtgaccagaagaagccgagt
tttctcgctatcaatccatttggtcaagtcccagttttcctagacgggggtcttaagttg
actgaatctcgagctatatctgaatacatagcgactgtccataaatcaagaggcacacaa
cttctgaattacaaaagctacaaaacaatgggaacacaaagaatgtggatggctatcgaa
tcttttgagtttgatccactcacatcaacactgacctgggaacaatccatcaagcctatg
tacggtctaaagacggactataaggttgtgaatgaaaccgaggcgaagctagagaaggtt
ctagatatatacgaagaacgactcaaaaattctagcttcttggctagtaacagcttcaca
atggctgatctttatcaccttcctaatatacaataccttatggacacacatacaaagaga
atgtttgtaaaccggccaagcgtgcgccggtgggtggctgagatcacagctagaccggct
tggaagagggcatgtgatgtgaaggcttggtaccataagaagaagaattaa

DBGET integrated database retrieval system