KEGG   Arabidopsis thaliana (thale cress): AT2G02010Help
Entry
AT2G02010         CDS       T00041                                 

Gene name
GAD4
Definition
(RefSeq) glutamate decarboxylase 4
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AT2G02010 (GAD4)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT2G02010 (GAD4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT2G02010 (GAD4)
   00430 Taurine and hypotaurine metabolism
    AT2G02010 (GAD4)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT2G02010 (GAD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 493 aa AA seqDB search
MVLSKTVSESDVSIHSTFASRYVRNSLPRFEMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMESINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLGDGEAAVG
VGTVGSSEAIMLAGLAFKRQWQNKRKAQGLPYDKPNIVTGANVQVCWEKFARYFEVELKE
VNLREDYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLVEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTKTDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMDNCRENMMVLRQGLEK
TGRFKIVSKENGVPLVAFSLKDSSRHNEFEVAHTLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVADFEKVLHELDTLPARVHAKMANGKVNGVKKTPEETQREVTAYWKK
LLETKKTNKNTIC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtctaagacagtttccgaatctgatgtctcaatccattcaacttttgcttct
cgttacgtccgcaactctcttccacgattcgaaatgcctgagaactcaatcccaaaagaa
gcagcttaccaaatcatcaacgacgagctaatgctcgatggtaacccaaggctgaaccta
gcttccttcgtgaccacatggatggagccagaatgtgacaagctcatgatggagtccatc
aacaagaactacgtcgacatggacgagtaccctgtcaccactgagcttcagaaccgatgt
gttaacatgatagcacgtctcttcaacgcgccgcttggtgacggtgaagctgccgttggt
gttggcaccgtcggatcgtcggaggcgattatgttggccggtttggcttttaagagacaa
tggcagaataagcgtaaggcccaagggcttccttatgataagcccaatatcgtaaccggt
gctaatgtccaggtttgctgggagaaattcgcaaggtatttcgaagtggagcttaaggaa
gtgaacctaagagaagactattacgtgatggaccctgtaaaggcggtcgaaatggtagac
gaaaacacaatttgtgtcgctgccatcctcggttcaacgttaaccggtgaattcgaagac
gttaagctcctcaacgacctccttgtcgagaaaaacaagcaaaccggatgggacacgcca
atacacgtggacgcagcgagtggtgggtttattgctccgttcttgtatccggagctggag
tgggatttccggctaccgttggttaagagtattaatgtgagtggtcacaaatacggtttg
gtttacgccggtattggttgggttgtatggagaaccaaaaccgatttgcctgatgaactt
atcttccatatcaattatcttggcgctgatcaaccaacctttacactcaacttctccaaa
ggttcaagtcaagtgattgctcagtactaccagctgattcgtcttggattcgagggttat
cgcaatgtgatggataattgtcgggaaaacatgatggtactaagacaaggattagagaaa
acgggacgttttaaaatcgtctccaaagaaaacggtgttccgttagtggcgttttctctc
aaagatagtagccgccacaacgagttcgaggtggcccatacactccgtcgcttcggctgg
atcgttccggcctacacgatgcctgcggatgcgcagcatgtcactgtccttcgagttgtt
atccgagaagatttctctcgaaccttagccgagagattggtagctgatttcgagaaggtt
ctacacgagctcgatacgcttccggcgagggttcacgccaagatggctaatggaaaagtt
aacggtgttaagaagacgccagaggagacgcagagagaagtcacggcctactggaagaag
ttgttggagactaagaagaccaacaagaacacaatttgctaa

DBGET integrated database retrieval system