KEGG   Arabidopsis thaliana (thale cress): AT3G07800Help
Entry
AT3G07800         CDS       T00041                                 

Gene name
TK1a
Definition
(RefSeq) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT3G07800 (TK1a)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AT3G07800 (TK1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 238 aa AA seqDB search
MATLKASFLIKTLDSDVTGDFLSDLERRGSGAVHVIMGPMFSGKSTSLLRRIKSEISDGR
SVAMLKSSKDTRYAKDSVVTHDGIGFPCWALPDLMSFPEKFGLDAYNKLDVIGIDEAQFF
GDLYEFCCKVADDDGKIVIVAGLDGDYLRRSFGAVLDIIPIADSVTKLTARCEVCGHKAF
FTLRKNCDTRTELIGGADVYMPVCRKHYITNHIVIKASKKVLEDSDKARAESCVAATI
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcgactctcaaagcttcctttttgatcaaaaccctcgacagtgacgtcaccggagat
tttctctccgatctggaacgtcgtgggtcaggtgctgttcatgttatcatgggtcctatg
ttttctgggaaatcgacctctctccttcgccgaatcaagtcagagatcagcgacggaaga
agtgttgcgatgctgaaatcgagtaaggatacgagatacgcaaaagattcggtggtgaca
catgatggaattggattcccttgctgggctcttccagatctcatgtcatttcctgagaaa
ttcggactagatgcttataacaagcttgatgtgattggtattgatgaggctcagttcttt
ggagatctttatgagttttgctgcaaagtcgctgatgatgatggtaaaattgtgatcgtt
gctggcctagatggtgactatttaaggaggagttttggggctgtacttgacattatacca
atagctgattctgtgactaagctaactgcaaggtgtgaggtctgtggacataaagctttc
ttcactttaagaaagaattgtgacaccagaactgagcttattggtggagctgatgtctat
atgcctgtttgtcgcaagcattacatcactaatcatattgttattaaagcctctaagaaa
gtcttggaagattctgacaaggctagagctgaatcctgtgttgctgctacaatctaa

DBGET integrated database retrieval system