Arabidopsis thaliana (thale cress): AT3G21850 Help Entry AT3G21850         CDS       T00041                                  Symbol SK9 Name (RefSeq) SKP1-like 9   KO K03094   S-phase kinase-associated protein 1 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath03083   Polycomb repressive complex ath04120   Ubiquitin mediated proteolysis ath04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AT3G21850 (SK9)    04120 Ubiquitin mediated proteolysis     AT3G21850 (SK9)   09126 Chromosome    03083 Polycomb repressive complex     AT3G21850 (SK9)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT3G21850 (SK9)    04121 Ubiquitin system [BR:ath04121]     AT3G21850 (SK9)    03036 Chromosome and associated proteins [BR:ath03036]     AT3G21850 (SK9) Membrane trafficking [BR:ath04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     AT3G21850 (SK9) Ubiquitin system [BR:ath04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      AT3G21850 (SK9)    Cul7 complex      AT3G21850 (SK9) Chromosome and associated proteins [BR:ath03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      AT3G21850 (SK9)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      AT3G21850 (SK9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  821739 NCBI-ProteinID:  NP_566694 TAIR:  AT3G21850 UniProt:  Q9LSX9 A0A654F9I8 LinkDB All DBs Position 3:complement(7697033..7697616) Genome browser AA seq 153 aa AA seqDB search MSTKKIILKSSDGHSFEVEEEAARQCQIIIAHMSENDCTDNGIPLPNVTGKILAMVIEYC NKHHVDAANPCSDDDLKKWDKEFMEKDTSTIFDLIKAANYLNIKSLFDLACQTVAEIIKG NTPEQIREFFNIENDLTPEEEAAIRRENKWAFE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtcgacgaagaagatcatattgaagagctccgatggtcactcattcgaggtcgaagaa gaggccgcacgccaatgccagattatcatagctcatatgagtgaaaatgattgtaccgat aatggaatccctcttccaaacgtgacaggcaagattcttgcgatggtgatcgagtactgc aacaagcaccacgtcgatgccgctaatccttgctccgacgatgatctcaagaagtgggac aaggagttcatggaaaaagatacatccacgatctttgatctcatcaaggctgcgaattac ctaaacatcaaaagcctttttgatctagcatgccaaaccgtcgcggaaatcatcaaaggc aacactcctgagcagattcgcgaattcttcaacattgagaatgatttaacacctgaggaa gaagcagcgattcgtagggagaataaatgggcttttgaatga

DBGET integrated database retrieval system