KEGG   Arabidopsis thaliana (thale cress): AT5G57160Help
Entry
AT5G57160         CDS       T00041                                 

Gene name
ATLIG4
Definition
(RefSeq) DNA ligase IV
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AT5G57160 (ATLIG4)
Enzymes [BR:ath01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AT5G57160 (ATLIG4)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     AT5G57160 (ATLIG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
LinkDB All DBs
Position
5
AA seq 1219 aa AA seqDB search
MTEEIKFSVLVSLFNWIQKSKTSSQKRSKFRKFLDTYCKPSDYFVAVRLIIPSLDRERGS
YGLKESVLATCLIDALGISRDAPDAVRLLNWRKGGTAKAGANAGNFSLIAAEVLQRRQGM
ASGGLTIKELNDLLDRLASSENRAEKTLVLSTLIQKTNAQEMKWVIRIILKDLKLGMSEK
SIFQEFHPDAEDLFNVTCDLKLVCEKLRDRHQRHKRQDIEVGKAVRPQLAMRIGDVNAAW
KKLHGKDVVAECKFDGDRIQIHKNGTDIHYFSRNFLDHSEYAHAMSDLIVQNILVDKCIL
DGEMLVWDTSLNRFAEFGSNQEIAKAAREGLDSHKQLCYVAFDVLYVGDTSVIHQSLKER
HELLKKVVKPLKGRLEVLVPEGGLNVHRPSGEPSWSIVVHAAADVERFFKETVENRDEGI
VLKDLESKWEPGDRSGKWMKLKPEYIRAGADLDVLIIGGYYGSGRRGGEVAQFLVALADR
AEANVYPRRFMSFCRVGTGLSDDELNTVVSKLKPYFRKNEHPKKAPPSFYQVTNHSKERP
DVWIDSPEKSIILSITSDIRTIRSEVFVAPYSLRFPRIDKVRYDKPWHECLDVQAFVELV
NSSNGTTQKQKESESTQDNPKVNKSSKRGEKKNVSLVPSQFIQTDVSDIKGKTSIFSNMI
FYFVNVPRSHSLETFHKMVVENGGKFSMNLNNSVTHCIAAESSGIKYQAAKRQRDVIHFS
WVLDCCSRNKMLPLLPKYFLHLTDASRTKLQDDIDEFSDSYYWDLDLEGLKQVLSNAKQS
EDSKSIDYYKKKLCPEKRWSCLLSCCVYFYPYSQTLSTEEEALLGIMAKRLMLEVLMAGG
KVSNNLAHASHLVVLAMAEEPLDFTLVSKSFSEMEKRLLLKKRLHVVSSHWLEESLQREE
KLCEDVYTLRPKYMEESDTEESDKSEHDTTEVASQGSAQTKEPASSKIAITSSRGRSNTR
AVKRGRSSTNSLQRVQRRRGKQPSKISGDETEESDASEEKVSTRLSDIAEETDSFGEAQR
NSSRGKCAKRGKSRVGQTQRVQRSRRGKKAAKIGGDESDENDELDGNNNVSADAEEGNAA
GRSVENEETREPDIAKYTESQQRDNTVAVEEALQDSRNAKTEMDMKEKLQIHEDPLQAML
MKMFPIPSQKTTETSNRTTGEYRKANVSGECESSEKRKLDAETDNTSVNAGAESDVVPPL
VKKKKVSYRDVAGELLKDW
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggagatcaaattcagcgtactggtatctctctttaactggattcaaaaaagc
aaaacctcatctcagaaacgatccaaattccgcaagtttctcgacacttactgcaaaccc
tccgactacttcgtcgccgtccgtttaatcattccgtcgcttgatcgagaacgaggtagc
tacggccttaaagagtcagtgctcgccacgtgtctgatcgacgcacttggtatctcgcgt
gatgctcctgatgctgttcgtcttctcaattggcgtaaaggaggaactgctaaagctgga
gccaatgctggaaacttctccttaattgctgctgaggtattgcaacgtagacaaggaatg
gcttctggcggtttgactattaaggaattgaatgatttgcttgatcgtttggcttcaagt
gagaacagagcggagaaaactttggttctttctacattgattcagaagacaaatgctcag
gagatgaagtgggtcattaggattattctaaaagatttgaaactgggaatgagtgagaag
agcatttttcaggagttccatccagatgctgaggacttgtttaatgtcacatgtgatttg
aaactagtctgtgaaaagttgagggatcgacaccaacggcacaagcgccaggatatagag
gttggaaaagccgtacgaccccagttagctatgcgtattggtgacgtaaatgctgcttgg
aagaagctgcatgggaaagatgtagttgctgaatgcaaatttgatggggatcgcatacaa
atacacaaaaatgggactgacatacattacttctctaggaacttccttgaccattctgaa
tacgcacatgccatgtcggatcttattgtacaaaatatattggtggacaagtgtatcctt
gatggtgaaatgttggtctgggatacatctctgaatcggtttgctgagtttggttcgaat
caggaaatagccaaggcagcaagggagggtcttgacagccataaacagttgtgttatgtt
gcctttgatgttctttatgttggcgatactagcgtcatccaccagagtttgaaggaacgg
catgaactgctgaagaaagtggtcaaacctttaaaaggtcggctcgaagttttagtacct
gaaggtggtctcaatgttcaccgcccttcaggggaacctagttggtctattgttgttcat
gctgctgctgatgttgagcgatttttcaaagaaacagttgaaaacagagatgaaggaatt
gtgcttaaagacctggaatcaaaatgggaacctggagatcgtagtggcaagtggatgaaa
ttgaagcctgaatatatccgggctggtgctgacctggatgttcttataataggaggatac
tatggctccggacgtcgtggaggagaggtagcacagtttcttgtagccttggctgaccgg
gcagaggcaaatgtatatcccaggcgatttatgtccttttgtagagttggcactgggctt
tctgatgatgagcttaacactgttgtaagcaaactgaagccttatttcagaaaaaatgag
cacccaaagaaggctccaccaagcttctatcaggtcactaatcactccaaagagagaccg
gatgtttggattgacagcccggaaaaatcaataatactttcaatcactagtgatatcagg
acgataaggtctgaggtgtttgttgcaccttacagtctgaggtttcctcgtattgataaa
gtaagatatgacaagccttggcatgaatgtcttgatgtgcaggcttttgtggaattggtg
aattcgagtaacggcaccacacagaaacagaaggagtctgaaagcacacaggacaatccg
aaagtcaataaatcctccaagagaggagagaaaaagaatgtctctcttgttccctctcag
tttattcaaactgatgtatcggatatcaagggcaagacctcaatcttctcaaatatgata
ttttattttgttaacgtgcctcggtcccattctcttgagacattccacaaaatggtggtt
gaaaacggagggaagttttcaatgaacttaaacaactcagtgactcattgcattgcagca
gaaagcagtggaataaagtatcaggcagcaaagcgtcagcgagatgtcatccacttttca
tgggtcttagattgttgttcacgaaataagatgcttcctttgctgccaaagtacttcctc
cacctcactgatgcttcaaggacaaaattacaggatgatattgatgaattttctgattct
tattactgggatttagaccttgaaggtctcaaacaggtcttaagcaatgccaagcaatct
gaagattcaaaatctattgactactacaagaaaaagttatgtcctgaaaaaagatggtcc
tgcctcttaagctgctgtgtttacttttacccgtatagtcaaacattgagcactgaagag
gaagccctattgggaattatggctaagagattaatgcttgaagtcttaatggctggtggt
aaagttagcaataatcttgctcatgcgtcgcaccttgtagttcttgctatggcagaagaa
cctttggattttactttagtttcgaaaagtttcagcgaaatggagaaacgtcttttgctg
aagaaaaggcttcatgttgttagctcgcactggttagaggaaagcttgcaaagagaggaa
aaactgtgcgaggatgtctacactctgaggcctaagtatatggaagagtctgatactgaa
gaatcagataaatccgaacatgatacaacggaagtagcttcccaaggtagtgctcaaacc
aaagagccagcttcctctaaaattgcaattacgagttcaagaggacggtcaaatactcga
gctgttaaaaggggaaggtcttctacaaactcactgcaacgagtacagagacgcagaggc
aagcagccgtctaagataagcggagatgaaacagaggaaagtgatgcttctgaagaaaag
gtttcaacaagactcagtgatatagcagaagagacggattcgtttggtgaggctcaaaga
aactctagcagaggaaaatgtgcgaagagaggaaagtctcgtgtgggacaaacccaaaga
gtacagagatcacgcagaggcaagaaagctgcgaagataggaggagatgagtctgatgaa
aatgatgaattagatggcaataacaatgtgtcagcagatgcggaagagggtaatgcagct
ggtagatctgtggaaaacgaagaaacccgagagcctgacatagcgaagtacacagaatca
cagcaaagagacaacacagtagcagttgaagaggccttacaagattctagaaatgcaaag
acggagatggatatgaaagagaagttacaaatccatgaggatccactacaagctatgtta
atgaaaatgttccctattcccagtcaaaaaaccacagagacatcaaaccgaaccactggg
gaatatagaaaggctaatgtttctggtgaatgtgagtcttcagagaaaagaaaactcgac
gctgagactgataatacatctgtgaacgcaggcgcagaatcagacgtagttcctcctcta
gtgaagaaaaagaaagtcagctaccgggatgttgccggagaactgctcaaagactggtga

DBGET integrated database retrieval system