KEGG   Azospirillum thiophilum: AL072_16575Help
Entry
AL072_16575       CDS       T04091                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ati  Azospirillum thiophilum
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ati00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AL072_16575
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AL072_16575
Enzymes [BR:ati01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AL072_16575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:628354..628794
Genome map
AA seq 146 aa AA seqDB search
MRLTQGQFSFLPDLTVGEITAQVQYALDQGWAVAVEFTDDPHPRNSYWTMWGNPMFDLRD
AKGVTMEIDACRTAHPDHYVKVLAFDGSEGFETVRMSFLVNRPAVEPGFELLRAEGPGRR
IGYTVRSYATGRPAGERYGTGTGHGG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttacccagggccagttctccttcctgcccgacctgacggtgggcgagatcacc
gcgcaggtccaatatgccctcgaccagggctgggcggtggcggtggagttcaccgacgac
ccgcacccgcgcaacagctattggacgatgtggggcaacccgatgtttgacctgcgcgac
gccaagggcgtgacgatggagatcgacgcctgccgcaccgcccatcccgaccactacgtc
aaggtgctggccttcgacggctcggaggggttcgagacggtgcgcatgtccttcctggtc
aaccgcccggcggtcgagcccggtttcgagctgctgcgcgccgaggggccgggccggcgc
atcggctacacggtgcgcagctacgccaccggccgcccggcgggggagcgctatggtacg
gggaccggtcatggcggctga

DBGET integrated database retrieval system