KEGG   Azospirillum thiophilum: AL072_16575Help
Entry
AL072_16575       CDS       T04091                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ati  Azospirillum thiophilum
Pathway
ati00630  Glyoxylate and dicarboxylate metabolism
ati00710  Carbon fixation in photosynthetic organisms
ati01100  Metabolic pathways
ati01120  Microbial metabolism in diverse environments
ati01200  Carbon metabolism
Module
ati_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ati_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ati00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AL072_16575
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AL072_16575
Enzymes [BR:ati01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AL072_16575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ALG72648
UniProt: A0A0F2KXN6
LinkDB All DBs
Position
2:628354..628794
Genome map
AA seq 146 aa AA seqDB search
MRLTQGQFSFLPDLTVGEITAQVQYALDQGWAVAVEFTDDPHPRNSYWTMWGNPMFDLRD
AKGVTMEIDACRTAHPDHYVKVLAFDGSEGFETVRMSFLVNRPAVEPGFELLRAEGPGRR
IGYTVRSYATGRPAGERYGTGTGHGG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttacccagggccagttctccttcctgcccgacctgacggtgggcgagatcacc
gcgcaggtccaatatgccctcgaccagggctgggcggtggcggtggagttcaccgacgac
ccgcacccgcgcaacagctattggacgatgtggggcaacccgatgtttgacctgcgcgac
gccaagggcgtgacgatggagatcgacgcctgccgcaccgcccatcccgaccactacgtc
aaggtgctggccttcgacggctcggaggggttcgagacggtgcgcatgtccttcctggtc
aaccgcccggcggtcgagcccggtttcgagctgctgcgcgccgaggggccgggccggcgc
atcggctacacggtgcgcagctacgccaccggccgcccggcgggggagcgctatggtacg
gggaccggtcatggcggctga

DBGET integrated database retrieval system