KEGG   Azospirillum thiophilum: AL072_29780Help
Entry
AL072_29780       CDS       T04091                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
ati  Azospirillum thiophilum
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ati00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AL072_29780
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AL072_29780
Enzymes [BR:ati01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AL072_29780
Peptidoglycan biosynthesis and degradation proteins [BR:ati01011]
 Precursor biosynthesis
  Racemase
   AL072_29780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6:320107..321255
Genome map
AA seq 382 aa AA seqDB search
MPAPEPVPQPVPSDPAARAGAFLTVDLAAVVANWTQLRDRVAPAECSAVVKADAYGLGVA
RVVPALAAAGCRTFVVAQFEEALAVRRALEPVAPDAQVFSLGGLPAGCEGDFIANRILPV
LNHLGEIAAWGAFAALRGGALPAVIHIDTGMNRLGLGPDELDALAAEPARLAGIDVRYWM
THLACADEFDNPMTGAQLDRFRSALARLPKAKASFANSSGIFHGPDHHFDLARPGCALYG
VNPTPHLPNPMRGTVRLDARLLQVRNCTPAMTVGYGAAHAVTGPARIATIGVGYADGYLR
ALGGKGQVFVDGVAAPIVGRISMDLITIDVSGLPEQVAHAGRMVELIGPSRPVDRVAAEG
GTIGYEILTSLGRRYHRVYLGG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgccccagagcctgtcccccagcctgtcccgtccgatccggccgcccgcgccggg
gccttcctcaccgtggatctcgccgcggtggtcgcaaactggacccagctgcgcgaccgc
gtggcgccggccgaatgctcggccgtggtcaaggccgacgcctacggcctcggcgtcgcc
cgcgtcgtcccggcgcttgccgcggccggctgccggaccttcgtcgtcgcgcagttcgag
gaggcgctggcggtccgccgtgcgctggagccggtggcgccggacgcgcaggtcttctcg
ctcggcgggctgccggccggctgcgagggcgacttcatcgccaaccgcatcctgccggtg
ctgaaccatctgggcgagatcgccgcctggggcgccttcgccgcgttgcgcggcggggcg
ctgccggcggtgatccacatcgacaccggcatgaaccgcctcggcctcggccccgacgag
ctggacgcgctggccgccgagccggcccggctggccggcatcgacgtgcgctattggatg
acgcatctggcctgcgccgacgagttcgacaatccgatgaccggggcgcagctcgaccgc
ttccgctccgcgctcgcccgcctgccgaaggccaaggcaagcttcgccaactcgtcgggc
atcttccacgggccggaccatcatttcgacctcgcccggccgggctgcgcgctgtacggc
gtcaacccgacgccgcacctgcccaacccgatgcgcggcacggtgcggctggacgcaagg
ctgctgcaggtgcgcaactgcaccccggcgatgacggtcggctacggcgccgcccatgcc
gtcaccggcccggcccggatcgccaccatcggcgtcggctatgccgacggctacctgcgc
gcgctgggcggcaaggggcaagtcttcgtcgatggtgtcgccgcccccatcgtcggccgc
atctcgatggacctgatcaccatcgacgtcagcggcctgccggagcaggttgcccatgcc
ggccgcatggtcgagctgatcggccccagccgcccggtcgaccgggtggcggcggagggc
ggcaccatcggctacgagatcctgacctcgctcggccggcgctaccaccgggtctatctg
ggcgggtga

DBGET integrated database retrieval system