KEGG   Agrobacterium vitis: Avi_1245Help
Entry
Avi_1245          CDS       T00851                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
avi  Agrobacterium vitis
Brite
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Avi_1245 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(1049886..1050488)
Genome map
AA seq 200 aa AA seqDB search
MAFELPALPYAYDALGPFMSAETLEFHHDKHHQAYVTNGNNLLKDSGLEGLSLEEVVKQS
YGKNAGLFNNAGQHYNHVHFWNWLKKDGGGTKLPGKLEAAIASDLGGYDKFKADFIAAGT
TQFGSGWAWLSVKDGKLEISKTPNGENPLIHGASPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDYVAELYEAATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaacttcccgcacttccctacgcttacgatgcactcggcccattcatgtcg
gccgaaacgctggaattccaccacgacaagcatcatcaggcctatgtcaccaacggcaat
aatctgctgaaggattcgggccttgaagggctttcgctggaggaagtcgtcaagcagtcc
tatggcaagaatgccggcctgttcaacaatgccggccagcactacaaccacgtgcatttc
tggaactggttgaagaaagacggcggcggcaccaagctgcctggcaagctggaagcagcg
attgcttccgatctcggtggctacgacaagttcaaggccgatttcatcgccgctggcacc
acccagttcggctccggctgggcctggctctccgtcaaggacggcaagctggaaatttcc
aagaccccgaatggcgaaaacccgctgatccatggcgcatcgcccatcctcggcgtcgat
gtctgggaacattcctactatatcgactaccgcaacgcccgcccgaaatatctggaagcc
ttcgtggatagcctgatcaactgggattacgtggccgagctttacgaagccgccaccaag
taa

DBGET integrated database retrieval system