KEGG   Azotobacter vinelandii DJ: Avin_13270Help
Entry
Avin_13270        CDS       T00885                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
avn  Azotobacter vinelandii DJ
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Avin_13270 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Avin_13270 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Avin_13270 (ddl)
Enzymes [BR:avn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Avin_13270 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:avn01011]
 Precursor biosynthesis
  Amino acid ligase
   Avin_13270 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1291484..1292431
Genome map
AA seq 315 aa AA seqDB search
MNHALKSTLAPQAFGRVAVLFGGKSAERAVSLKSGQAVLEALQSAGVDAFGIDVGDDLLE
RLGRERIDRAFIVLHGRGGEDGSMQGLLECVGIPYTGSGVLASALAMDKLRTKQVWQSLG
LPTPRHAVPTSESDCRAAARDLGFPLIVKPAHEGSSIGMAKVNDIDELIAAWLSARSHDP
QVLVEQWIQGPEFTVALLRGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLDSSKEE
ELKALCARACEAVGVQGWARVDVMQDAEGRFWLLEVNTVPGMTDHSLVPMAARAAGLDFQ
QLVLAVLADSVEARG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgccctgaagtccacactggctccgcaagccttcggtcgtgtcgccgtactg
ttcggcggcaagagcgccgagcgggcggtctccctgaagtccggccaggccgtgctggaa
gcgctgcagagcgccggcgtggacgctttcggcatcgacgtcggcgacgacctgctcgag
cgactgggtcgcgagcggatcgatcgggccttcatcgtcctgcatggccgtggcggcgag
gatggcagcatgcagggcctgctcgaatgtgtcggcattccctacaccggcagcggcgtt
ctcgcttcggccctggcgatggacaagctgcgcaccaagcaggtctggcagagcctgggg
ttgccgacgccgcgccatgcggtgccgaccagcgagagcgactgccgggccgccgcacgg
gatctcggttttccgctgatcgtcaagccggcccacgaaggctcgagcatcggcatggcc
aaggtgaatgacatcgacgaactgatcgccgcctggctgtctgcccgctcccatgacccc
caggtgctggtcgagcagtggatccaggggccggagttcaccgtcgccctattgcgtggg
caggtgttacctccgatcggtctgggcacgccgcacagtttctacgattacgacgccaag
tatctggcctcggatacccagtaccggattccctgcgggctcgattccagcaaggaggag
gagttgaaggcgttgtgcgcgcgtgcctgcgaggcggtgggggtgcagggttgggcgcgg
gtcgacgtgatgcaggacgcggagggccgcttctggctgcttgaagtcaatacggtgccg
ggcatgaccgatcatagtctggtgccgatggccgcgcgtgccgcgggactggatttccag
caactggtgctggcggttctggccgacagcgtcgaggcaaggggctga

DBGET integrated database retrieval system