KEGG   Aeromonas veronii TH0426: AMS64_10985Help
Entry
AMS64_10985       CDS       T04529                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
avo  Aeromonas veronii TH0426
Pathway
avo00473  D-Alanine metabolism
avo00550  Peptidoglycan biosynthesis
avo01100  Metabolic pathways
avo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:avo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMS64_10985
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMS64_10985
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AMS64_10985
Enzymes [BR:avo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AMS64_10985
Peptidoglycan biosynthesis and degradation proteins [BR:avo01011]
 Precursor biosynthesis
  Amino acid ligase
   AMS64_10985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AMQ42856
UniProt: A0A142E3W8
LinkDB All DBs
Position
complement(2399332..2400321)
Genome map
AA seq 329 aa AA seqDB search
MKNMHVLLLCGGGGSEHEVSLRSANFLEQQLGLLPGVEVTRVEMFADRWLSADGRECKLG
LDKLLSFDSVARPVDYVVPCIHGYPGETGDLQSFLELAGLPYLGCDAEASKICFNKISTK
LWLSAIGIPNTPYLFLTEQNETALAEAKAALAKWGKVFIKAASQGSSVGCYSASNEADLV
KGIADAFGYSEQVLIEKAVKPRELEVAVYQYGDELVATYPGEICVPQDKFYTYEEKYSSA
SHTETALRAEGLTQAQADAIHEYALKAFRQLKLTHLSRIDFFLTDEGEILLNEINTFPGM
TSISMFPKLLEHHGHRFADYLEQILRKAS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgcatgtcttgctgctgtgcggcggcggtggctccgagcacgaggtttct
ctgcgcagcgccaatttcctcgagcaacaactgggccttctgcccggtgtcgaagtgacc
cgcgtcgagatgttcgccgatcgctggctcagtgccgatggccgcgagtgcaagctgggg
ctcgacaagctgctttcgtttgacagcgtggcccgtccggtggattacgtggtgccctgc
atccacggctacccgggtgagaccggcgatctgcaatccttcctcgaactggccggattg
ccttatctcggttgtgatgccgaggcgagcaagatctgcttcaacaagatcagcaccaag
ctgtggctctccgccattggcattcctaacaccccgtacctgttcctgaccgagcaaaat
gagacggcgctggccgaggccaaagccgcgctggccaagtggggcaaggtctttatcaag
gccgcttcccaaggctcttccgttggctgctactccgctagcaacgaagcggatctggta
aaaggtattgccgatgccttcggttactccgagcaggtactgattgagaaggcggtcaag
ccgcgcgagctggaagtggcggtttaccagtatggtgacgagctggtggcgacttatccg
ggcgagatctgcgtgccgcaggacaagttctacacctatgaagagaagtacagcagcgcc
agccataccgagacggcactacgtgccgaggggctgactcaggcgcaggccgatgcgatc
cacgagtatgccctcaaggcgttccgtcagctgaaactgacccatctctcccgcatcgac
ttcttcctgaccgacgagggggagatcctgctgaatgaaatcaacaccttcccgggcatg
acctccatctctatgttcccgaaactgctggagcatcacggtcaccgcttcgccgactac
cttgagcagatcctgcgcaaggccagctaa

DBGET integrated database retrieval system