KEGG   Anabaena sp. wa102: AA650_02345Help
Entry
AA650_02345       CDS       T04059                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
awa  Anabaena sp. wa102
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:awa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA650_02345
   00020 Citrate cycle (TCA cycle)
    AA650_02345
   00620 Pyruvate metabolism
    AA650_02345
Enzymes [BR:awa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AA650_02345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(581651..582940)
Genome map
AA seq 429 aa AA seqDB search
MSINEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVPAGETAPVGAAIAYIAETEAEIATAKSLANADNAAAPSTPAPTPVAVAAVAAPVTASQ
NGSNHQPGRVVVSPRARKLAKELKIDLNTLTGSGPYGRIVAEDVEVAVGKVQPIATPVVT
AAPVPVPVPVPVAAPAPVPVVSSAVPGQIVPFTTLQNAVVRGMVASLSVPVFRVSYTIST
DGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPILNASYSDEGIVNHPNINVSVAVAMDD
GGLITPVLQNADTVDIYSLSRNWKSLVERARAKQLQPAEYNSGTFTLSNLGMFGVDTFDA
ILPPGQGSILAIGASRPQVVATVDGLFGVRQQMQVTVTCDHRIIYGADAAGFLQDLAKLI
ETNPQFLTM
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaacgaagtatttatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtcaagtcgccgggagataaagtagagaaaggcgaaacggtggtggttgtc
gaatcagataaagctgatatggatgtagaaaccttctatgaaggatatctcgcccatatt
attgttcctgccggtgaaaccgcaccagtcggcgcagcgatcgcttacattgccgaaaca
gaagcagaaatagccacagccaagtccctagccaacgcagataacgctgctgccccctcg
acacctgctcccacaccagttgcagttgccgcagttgccgcccctgtcaccgcatctcaa
aatggttctaaccatcaaccgggcagagtcgtagtttcaccccgcgcccgtaaactagcc
aaagaactcaaaatagatttaaataccctcacaggtagcggtccctacggtcgcattgtc
gctgaggatgtagaagttgcagttggtaaagttcagccaattgctacccctgttgtcact
gccgccccagtaccagtaccagtaccagtaccagtagcagcaccagcacctgtgcctgta
gttagtagtgctgttcccggtcaaatagtaccattcactaccttacaaaatgccgtagtt
cggggtatggtagccagtctatccgtacctgtattccgtgttagttacacaattagcacc
gatggactcgataaactttacaaacaaattaagtctaaaggcgtaacaatgaccgcgcta
ctagccaaagctgtagccgtgacattgcaaaaacaccccatcctcaatgccagctactca
gacgaaggaattgtcaatcatcctaatattaacgtttccgtcgccgtagccatggatgat
ggtggtttaataacacccgttttgcaaaatgcagatacagttgacatctactctttatct
cgcaactggaaatccttagtagaacgcgctagagcgaaacagctacaaccagcagaatac
aacagcggtactttcaccctctccaacttgggaatgtttggtgtagatacctttgatgcc
attttaccacctggacaaggttctatcttagccattggtgcatcacgtcctcaggtagta
gccacagtcgacggcttatttggtgtacgtcaacaaatgcaagtaactgttacctgtgat
catcgcatcatttatggtgctgatgccgccggattcttgcaagacttagcaaaattgatt
gaaaccaatcctcagtttttgacaatgtaa

DBGET integrated database retrieval system