KEGG   Anabaena sp. wa102: AA650_02345Help
Entry
AA650_02345       CDS       T04059                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
awa  Anabaena sp. wa102
Pathway
awa00010  Glycolysis / Gluconeogenesis
awa00020  Citrate cycle (TCA cycle)
awa00620  Pyruvate metabolism
awa01100  Metabolic pathways
awa01110  Biosynthesis of secondary metabolites
awa01120  Microbial metabolism in diverse environments
awa01130  Biosynthesis of antibiotics
awa01200  Carbon metabolism
Module
awa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:awa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA650_02345
   00020 Citrate cycle (TCA cycle)
    AA650_02345
   00620 Pyruvate metabolism
    AA650_02345
Enzymes [BR:awa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AA650_02345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase SOBP
Motif
Other DBs
NCBI-ProteinID: ALB39456
UniProt: A0A0K2LUY3
LinkDB All DBs
Position
complement(581651..582940)
Genome map
AA seq 429 aa AA seqDB search
MSINEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVPAGETAPVGAAIAYIAETEAEIATAKSLANADNAAAPSTPAPTPVAVAAVAAPVTASQ
NGSNHQPGRVVVSPRARKLAKELKIDLNTLTGSGPYGRIVAEDVEVAVGKVQPIATPVVT
AAPVPVPVPVPVAAPAPVPVVSSAVPGQIVPFTTLQNAVVRGMVASLSVPVFRVSYTIST
DGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPILNASYSDEGIVNHPNINVSVAVAMDD
GGLITPVLQNADTVDIYSLSRNWKSLVERARAKQLQPAEYNSGTFTLSNLGMFGVDTFDA
ILPPGQGSILAIGASRPQVVATVDGLFGVRQQMQVTVTCDHRIIYGADAAGFLQDLAKLI
ETNPQFLTM
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaacgaagtatttatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtcaagtcgccgggagataaagtagagaaaggcgaaacggtggtggttgtc
gaatcagataaagctgatatggatgtagaaaccttctatgaaggatatctcgcccatatt
attgttcctgccggtgaaaccgcaccagtcggcgcagcgatcgcttacattgccgaaaca
gaagcagaaatagccacagccaagtccctagccaacgcagataacgctgctgccccctcg
acacctgctcccacaccagttgcagttgccgcagttgccgcccctgtcaccgcatctcaa
aatggttctaaccatcaaccgggcagagtcgtagtttcaccccgcgcccgtaaactagcc
aaagaactcaaaatagatttaaataccctcacaggtagcggtccctacggtcgcattgtc
gctgaggatgtagaagttgcagttggtaaagttcagccaattgctacccctgttgtcact
gccgccccagtaccagtaccagtaccagtaccagtagcagcaccagcacctgtgcctgta
gttagtagtgctgttcccggtcaaatagtaccattcactaccttacaaaatgccgtagtt
cggggtatggtagccagtctatccgtacctgtattccgtgttagttacacaattagcacc
gatggactcgataaactttacaaacaaattaagtctaaaggcgtaacaatgaccgcgcta
ctagccaaagctgtagccgtgacattgcaaaaacaccccatcctcaatgccagctactca
gacgaaggaattgtcaatcatcctaatattaacgtttccgtcgccgtagccatggatgat
ggtggtttaataacacccgttttgcaaaatgcagatacagttgacatctactctttatct
cgcaactggaaatccttagtagaacgcgctagagcgaaacagctacaaccagcagaatac
aacagcggtactttcaccctctccaacttgggaatgtttggtgtagatacctttgatgcc
attttaccacctggacaaggttctatcttagccattggtgcatcacgtcctcaggtagta
gccacagtcgacggcttatttggtgtacgtcaacaaatgcaagtaactgttacctgtgat
catcgcatcatttatggtgctgatgccgccggattcttgcaagacttagcaaaattgatt
gaaaccaatcctcagtttttgacaatgtaa

DBGET integrated database retrieval system