KEGG   Anabaena sp. wa102: AA650_17350Help
Entry
AA650_17350       CDS       T04059                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
awa  Anabaena sp. wa102
Pathway
awa00620  Pyruvate metabolism
awa00680  Methane metabolism
awa00710  Carbon fixation in photosynthetic organisms
awa01100  Metabolic pathways
awa01120  Microbial metabolism in diverse environments
awa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:awa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA650_17350
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AA650_17350
   00680 Methane metabolism
    AA650_17350
Enzymes [BR:awa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AA650_17350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALB41978
UniProt: A0A0K2M1P3
LinkDB All DBs
Position
complement(3967930..3970971)
Genome map
AA seq 1013 aa AA seqDB search
MKSMKAEHIDFPVLHSELFLRHRLQVVEELWESVLRQECGQEMVDLLRQLRDLCSPEGQA
TNDLAASAVELIEQLNINEAIRAARAFALYFQLINIIEQEYEQKQQLNRYSGETDEEVFP
SIIYSTNQREEELPITKEIGSDLMTSETPQKGTFAALFPLLFKLNVPPQQIQRLISQLDI
RLVFTAHPTEIVRHTIRDKQRQVVHLLQKLDEAQNRAGSYPWETLEVKERLLEEIRLWWR
TDELHQFKPTVLDEVDYALHYFQEVLFDGITQLYKRFKYSLGETFPWLQPPTTNFCSFGS
WVGSDRDGNPSVTPEVTWKTACYQRKMVLERYIKSVKELVSLLSVSMHWSDVLPDLLESL
ELDQSQLSGVYDDLALRFRQEPYRLKLSYILKRLENTRDRNLALYNRETPNNEDAPMYRS
GTEFLTELLLIQRNLTETGLSCRELENLICQVEIFDFNLTQLDIRQESSRHADAINEILE
YLQLLPQSYNELSEEQRIAWLTSELQTRRPLIPAELPFSEKTNDVIETFRILRSLQQEFG
IKICQTYIISMCREVSDVLEVLLLAKESSLFDPVVAVGTIRIVPLFETVEDLQRSRGVMR
QLFELPLYRAMLAGGYAAINTSTPLSAKASTSLSAEAPPSISTLNPNLQEVMLGYSDSNK
DSGFLSSNWEIHKAQKSLQKIAESYGVNLRIFHGRGGSVGRGGGPAHEAILAQPGHSISG
RIKITEQGEVLASKYSLLDLALYHLETITTAVIQASLLGTGFDDIEPWNEIMEELSHASR
QHYRNLIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLSSLRAIPWVFSWTQT
RFLLPSWYGIGTALQEFLDAEPEQHLKLLRYFYLKWPFFKMVISKAEMTLAKVDMEMARH
YVDELSNPEDKPRFEKVFEQISSEFFLTRDLVLKITGHQKLLDGDPVLQRSVQLRNGTIV
PLGFIQVSLLKRLRQSKNAPTTGVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtatgaaagctgaacatattgattttccagtgctacactcagaattattctta
cgtcatcgtctacaggtagtagaggaattgtgggagtcggtgctgcgtcaagaatgcggt
caagaaatggtggatcttttgcgccaattgcgggacttatgttctccagagggacaagcc
acgaatgacttagctgcctcggctgtagaattaattgaacaattgaatatcaatgaagcg
attcgtgcggcgcgtgcctttgcgttgtattttcagttgattaatattattgagcaggaa
tatgagcaaaagcagcaattaaaccgctatagtggagaaactgatgaggaggtttttccc
agtataatttattctacgaaccaaagagaagaagaattgcctattactaaggaaataggt
agtgatttaatgacatcggaaactccgcaaaaagggactttcgcggctttatttcccctg
ttatttaagttgaatgttccaccccaacaaattcaacgtctaatttctcaactggatatc
cgcttagttttcactgcacacccgacggaaattgtccgtcatactatccgggataaacag
cgtcaggtggttcatcttttgcaaaaattagatgaagcccaaaatcgcgctggtagctat
ccttgggaaactttggaagtcaaggaaagattactggaagaaattcgcctgtggtggcgg
actgatgagttacatcagtttaaaccgacggttttggatgaagtagattatgctcttcac
tactttcaagaagtgttgtttgatggtattacgcaactatacaaacgcttcaaatattct
ttgggcgaaacttttccctggttacaaccaccaacgacaaatttttgctcttttggttct
tgggtaggttcagaccgagatggtaatccttcggtgacaccggaagtaacttggaaaacc
gcttgttatcaacgaaaaatggtgttagagcggtatattaagtcagttaaagagttagtg
tctttattgagtgtatctatgcactggagtgatgtactaccagatttgctagagtctttg
gagttggatcaatcacagttaagtggggtgtatgatgatttagcattgcgtttccgccaa
gaaccttatcgtctgaagttatcttacattctcaagcggttggaaaatacccgcgatcgc
aatttggctttatataatcgggaaacgccaaacaatgaagatgcaccaatgtaccgttct
ggtacagaatttttaacagaattgttgttaattcaacgcaatttaacagaaacaggttta
agttgtcgagagttggaaaacttgatttgtcaagtggaaatatttgactttaatctgact
caattagatattcgtcaagaatcatcccgtcatgctgacgctatcaatgagattctggaa
tacttacaactcttaccccagtcctacaacgaattatcagaagaacaaagaatagcttgg
ttaacttcagaattgcaaactcgtcgtcccttgattcccgctgagttaccattttcagaa
aaaaccaatgatgtaattgaaactttccgaattttgcgatcgctacaacaagaatttggc
attaaaatctgtcaaacttatattattagtatgtgccgcgaagtaagcgacgtactagaa
gttttactcttagccaaagaatcgagtttatttgatcctgtagttgcagtggggacaatt
cgcatcgttcctctgtttgaaacagtagaagatttacaacgttctagaggcgtaatgcga
caactgtttgaattgcctttatatcgggcaatgctggctggaggttacgccgcaattaac
acttcgactccgctcagtgcaaaagcttcgacttcgctcagtgcagaagcacctccatct
atttctactttgaatcctaacttacaagaagtaatgttggggtattccgatagtaataaa
gattctggttttttaagcagtaactgggaaattcataaggctcaaaaatcacttcagaaa
atcgccgaaagttacggtgtaaatctgcggattttccacggacgaggcggttctgtggga
cgtggtggcggtcctgctcatgaagcgattttagcccaaccaggtcacagtattagtggc
cggattaaaattaccgaacaaggggaagtcttagcttctaaatattccttgttagatttg
gctttgtatcacctagagactatcaccacagccgtaatccaagccagtttactaggaaca
gggtttgatgacatcgaaccttggaatgagatcatggaagagttatctcatgcgtcgcgt
cagcactatcgtaacctaatttatgagcaacctgattttattgacttcttccaccaagtc
acccccattgaagaaatcagccaattgcaaattagttctcgtccagcccgtcgtccatct
ggtaaaaaagatttaagtagtctgcgagcgattccttgggtatttagttggacacaaacc
cgctttttattaccttcctggtatggaattggtacagctttacaagaatttttggatgca
gaaccagaacaacatttgaaattactgcgttatttctacctcaaatggccattctttaaa
atggtgatttctaaagccgaaatgactttagcaaaagtagacatggaaatggcacgtcac
tatgttgatgaattgtcaaacccggaagacaaaccgcgatttgagaaagtttttgaacaa
atttctagcgaattctttcttaccagagatttagttttaaaaatcactggacaccaaaaa
ctattagatggtgatccagtattgcaacgttctgtacaattaagaaatggaacaattgtg
cctttaggatttatccaagtttccctattaaaacgccttcgtcaatcaaaaaacgccccc
acaaccggagtaattcactctcgttacagcaaaggagaattactccgaggagcattatta
accatcaacggaattgctgccggcatgagaaatacgggttga

DBGET integrated database retrieval system