KEGG   Anabaena sp. wa102: AA650_17350Help
Entry
AA650_17350       CDS       T04059                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
awa  Anabaena sp. wa102
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:awa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA650_17350
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AA650_17350
   00680 Methane metabolism
    AA650_17350
Enzymes [BR:awa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AA650_17350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3967930..3970971)
Genome map
AA seq 1013 aa AA seqDB search
MKSMKAEHIDFPVLHSELFLRHRLQVVEELWESVLRQECGQEMVDLLRQLRDLCSPEGQA
TNDLAASAVELIEQLNINEAIRAARAFALYFQLINIIEQEYEQKQQLNRYSGETDEEVFP
SIIYSTNQREEELPITKEIGSDLMTSETPQKGTFAALFPLLFKLNVPPQQIQRLISQLDI
RLVFTAHPTEIVRHTIRDKQRQVVHLLQKLDEAQNRAGSYPWETLEVKERLLEEIRLWWR
TDELHQFKPTVLDEVDYALHYFQEVLFDGITQLYKRFKYSLGETFPWLQPPTTNFCSFGS
WVGSDRDGNPSVTPEVTWKTACYQRKMVLERYIKSVKELVSLLSVSMHWSDVLPDLLESL
ELDQSQLSGVYDDLALRFRQEPYRLKLSYILKRLENTRDRNLALYNRETPNNEDAPMYRS
GTEFLTELLLIQRNLTETGLSCRELENLICQVEIFDFNLTQLDIRQESSRHADAINEILE
YLQLLPQSYNELSEEQRIAWLTSELQTRRPLIPAELPFSEKTNDVIETFRILRSLQQEFG
IKICQTYIISMCREVSDVLEVLLLAKESSLFDPVVAVGTIRIVPLFETVEDLQRSRGVMR
QLFELPLYRAMLAGGYAAINTSTPLSAKASTSLSAEAPPSISTLNPNLQEVMLGYSDSNK
DSGFLSSNWEIHKAQKSLQKIAESYGVNLRIFHGRGGSVGRGGGPAHEAILAQPGHSISG
RIKITEQGEVLASKYSLLDLALYHLETITTAVIQASLLGTGFDDIEPWNEIMEELSHASR
QHYRNLIYEQPDFIDFFHQVTPIEEISQLQISSRPARRPSGKKDLSSLRAIPWVFSWTQT
RFLLPSWYGIGTALQEFLDAEPEQHLKLLRYFYLKWPFFKMVISKAEMTLAKVDMEMARH
YVDELSNPEDKPRFEKVFEQISSEFFLTRDLVLKITGHQKLLDGDPVLQRSVQLRNGTIV
PLGFIQVSLLKRLRQSKNAPTTGVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtatgaaagctgaacatattgattttccagtgctacactcagaattattctta
cgtcatcgtctacaggtagtagaggaattgtgggagtcggtgctgcgtcaagaatgcggt
caagaaatggtggatcttttgcgccaattgcgggacttatgttctccagagggacaagcc
acgaatgacttagctgcctcggctgtagaattaattgaacaattgaatatcaatgaagcg
attcgtgcggcgcgtgcctttgcgttgtattttcagttgattaatattattgagcaggaa
tatgagcaaaagcagcaattaaaccgctatagtggagaaactgatgaggaggtttttccc
agtataatttattctacgaaccaaagagaagaagaattgcctattactaaggaaataggt
agtgatttaatgacatcggaaactccgcaaaaagggactttcgcggctttatttcccctg
ttatttaagttgaatgttccaccccaacaaattcaacgtctaatttctcaactggatatc
cgcttagttttcactgcacacccgacggaaattgtccgtcatactatccgggataaacag
cgtcaggtggttcatcttttgcaaaaattagatgaagcccaaaatcgcgctggtagctat
ccttgggaaactttggaagtcaaggaaagattactggaagaaattcgcctgtggtggcgg
actgatgagttacatcagtttaaaccgacggttttggatgaagtagattatgctcttcac
tactttcaagaagtgttgtttgatggtattacgcaactatacaaacgcttcaaatattct
ttgggcgaaacttttccctggttacaaccaccaacgacaaatttttgctcttttggttct
tgggtaggttcagaccgagatggtaatccttcggtgacaccggaagtaacttggaaaacc
gcttgttatcaacgaaaaatggtgttagagcggtatattaagtcagttaaagagttagtg
tctttattgagtgtatctatgcactggagtgatgtactaccagatttgctagagtctttg
gagttggatcaatcacagttaagtggggtgtatgatgatttagcattgcgtttccgccaa
gaaccttatcgtctgaagttatcttacattctcaagcggttggaaaatacccgcgatcgc
aatttggctttatataatcgggaaacgccaaacaatgaagatgcaccaatgtaccgttct
ggtacagaatttttaacagaattgttgttaattcaacgcaatttaacagaaacaggttta
agttgtcgagagttggaaaacttgatttgtcaagtggaaatatttgactttaatctgact
caattagatattcgtcaagaatcatcccgtcatgctgacgctatcaatgagattctggaa
tacttacaactcttaccccagtcctacaacgaattatcagaagaacaaagaatagcttgg
ttaacttcagaattgcaaactcgtcgtcccttgattcccgctgagttaccattttcagaa
aaaaccaatgatgtaattgaaactttccgaattttgcgatcgctacaacaagaatttggc
attaaaatctgtcaaacttatattattagtatgtgccgcgaagtaagcgacgtactagaa
gttttactcttagccaaagaatcgagtttatttgatcctgtagttgcagtggggacaatt
cgcatcgttcctctgtttgaaacagtagaagatttacaacgttctagaggcgtaatgcga
caactgtttgaattgcctttatatcgggcaatgctggctggaggttacgccgcaattaac
acttcgactccgctcagtgcaaaagcttcgacttcgctcagtgcagaagcacctccatct
atttctactttgaatcctaacttacaagaagtaatgttggggtattccgatagtaataaa
gattctggttttttaagcagtaactgggaaattcataaggctcaaaaatcacttcagaaa
atcgccgaaagttacggtgtaaatctgcggattttccacggacgaggcggttctgtggga
cgtggtggcggtcctgctcatgaagcgattttagcccaaccaggtcacagtattagtggc
cggattaaaattaccgaacaaggggaagtcttagcttctaaatattccttgttagatttg
gctttgtatcacctagagactatcaccacagccgtaatccaagccagtttactaggaaca
gggtttgatgacatcgaaccttggaatgagatcatggaagagttatctcatgcgtcgcgt
cagcactatcgtaacctaatttatgagcaacctgattttattgacttcttccaccaagtc
acccccattgaagaaatcagccaattgcaaattagttctcgtccagcccgtcgtccatct
ggtaaaaaagatttaagtagtctgcgagcgattccttgggtatttagttggacacaaacc
cgctttttattaccttcctggtatggaattggtacagctttacaagaatttttggatgca
gaaccagaacaacatttgaaattactgcgttatttctacctcaaatggccattctttaaa
atggtgatttctaaagccgaaatgactttagcaaaagtagacatggaaatggcacgtcac
tatgttgatgaattgtcaaacccggaagacaaaccgcgatttgagaaagtttttgaacaa
atttctagcgaattctttcttaccagagatttagttttaaaaatcactggacaccaaaaa
ctattagatggtgatccagtattgcaacgttctgtacaattaagaaatggaacaattgtg
cctttaggatttatccaagtttccctattaaaacgccttcgtcaatcaaaaaacgccccc
acaaccggagtaattcactctcgttacagcaaaggagaattactccgaggagcattatta
accatcaacggaattgctgccggcatgagaaatacgggttga

DBGET integrated database retrieval system