KEGG   Anabaena sp. wa102: AA650_18830Help
Entry
AA650_18830       CDS       T04059                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
awa  Anabaena sp. wa102
Pathway
awa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:awa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AA650_18830
Enzymes [BR:awa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AA650_18830
Transporters [BR:awa02000]
 Other Transporters
  Pores ion channels [TC:1]
   AA650_18830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_5 GST_C_3 GST_C Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ALB42234
UniProt: A0A0K2M2U0
LinkDB All DBs
Position
4279783..4280454
Genome map
AA seq 223 aa AA seqDB search
MADIKIYSAVVCPYAHRTRLVLQEKGIDFDLIEIDLQNKPAGFTKVSPYGKVPAITHGEN
RVWESAVINEYLDEVFPNPPLLPTNPIAKAQARIWIDFANTRLVPAFSTLLRSPDFQKQE
EAKQELYKHLEFIENEGLGKLSGDGPYWFGESISLVDFTFFPWFERWAALKHYRGFGIPA
EFTRLKQWKHALKERESVKAIAHSKEFYIERYAKFAAPVPVAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggctgacattaagatttatagtgcggttgtttgtccttatgctcaccgtacccgcttg
gtacttcaagaaaagggtattgatttcgatttgattgaaattgatttgcagaataaacca
gcaggttttacaaaagtttctccttatggaaaagtacctgcaattactcatggagaaaac
cgagtttgggaatcagcagttattaatgaatatctggatgaagtatttcctaacccaccg
cttttacctaccaaccccattgcaaaagctcaagctcgaatttggatagattttgctaat
actagattagttcctgctttttctactctattacgtagtccagattttcaaaagcaagag
gaagctaaacaagaactctacaaacatctagaatttattgaaaatgaaggtttaggaaaa
ctttcgggagatggtccctactggtttggtgaatctatcagtttggttgattttaccttt
ttcccctggtttgaaagatgggctgctcttaaacattatcgtggctttggtattcctgct
gaattcactcgtttgaaacagtggaaacacgcgcttaaagaacgtgaatcagtgaaagcg
atcgctcactccaaagagttctatattgagcgatatgctaaatttgctgctcctgttcct
gtggctgcttag

DBGET integrated database retrieval system