KEGG   Aliivibrio wodanis: AWOD_I_2508Help
Entry
AWOD_I_2508       CDS       T03808                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
awd  Aliivibrio wodanis
Brite
Translation factors [BR:awd03012]
 Eukaryotic Type
  Elongation factors
   AWOD_I_2508
 Prokaryotic Type
   AWOD_I_2508
Mitochondrial biogenesis [BR:awd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AWOD_I_2508
Exosome [BR:awd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AWOD_I_2508
  Exosomal proteins of breast cancer cells
   AWOD_I_2508
  Exosomal proteins of colorectal cancer cells
   AWOD_I_2508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(2850237..2851421)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGVAKDFASIDNAPEERERG
ITISTSHVEYDTPERHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDYPGDDLPVIQGSALGALQ
GEKQWEDKIVELAEALDSYIPLPERAVDMPFLLPIEDVFSIQGRGTVVTGRIERGILRVG
DEVEIIGIKETTVSTCTGVEMFRKLLDEGRAGENVGALLRGTKRDDVERGQVLAAKGSIN
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDITLPEGVEMVMPGDNVQMT
VELIAPIAMDEGLRFAIREGGRTVGAGVVAKIFA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacgaaaccgcacgtaaacgttggtactatcggccac
gtcgaccacggtaaaacaactctaactgctgctatctgtactacacttgcaaaagtgtac
ggtggtgttgctaaagatttcgcatcaatcgataacgctccagaagagcgcgagcgtggt
atcacaatctcaacttctcacgttgagtacgatacacctgagcgtcactatgcacacgtt
gactgtcctggacacgccgattatgttaaaaacatgatcactggtgctgctcaaatggat
ggtggtatcctagttgttgctgcaactgatggtccaatgccacaaacacgtgagcacatc
ctacttggtcgtcaagttggtatcccttacatcatcgtattcatgaacaaatgtgacatg
gttgatgatgaagagcttctagagctagtagaaatggaagttcgtgaacttctttctgaa
tacgattacccaggtgatgatttaccagtaatccaaggttcagctcttggtgctctacaa
ggcgaaaaacaatgggaagataaaatcgttgagcttgcagaagcactagattcttacatt
cctcttccagagcgtgctgtagacatgcctttcctacttcctattgaagatgtattctca
attcaaggtcgtggtactgttgttactggtcgtatcgaacgtggtatcctacgtgtaggt
gacgaagtagaaatcattggtatcaaagaaactacagtttctacatgtactggtgttgaa
atgttccgtaaactgcttgacgaaggtcgtgctggtgagaacgttggtgcacttctacgt
ggtactaagcgtgatgacgttgaacgtggccaagtacttgctgctaaaggttcaatcaac
ccacacactaaatttgagtcagaagtatacgttctttctaaagatgaaggcggccgtcat
actcctttcttcaaaggctaccgtccacagttttacttccgtacaacggatgtaactggc
gatatcacacttcctgaaggtgttgaaatggtaatgcctggtgacaacgttcaaatgacg
gttgagctaatcgctccaatcgctatggacgaaggtctacgcttcgcaatccgtgaaggt
ggccgtacagttggtgctggtgttgttgctaaaatcttcgcttaa

DBGET integrated database retrieval system