KEGG   Aliivibrio wodanis: AWOD_p920_71Help
Entry
AWOD_p920_71      CDS       T03808                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [Cu-Zn] precursor
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
awd  Aliivibrio wodanis
Brite
Enzymes [BR:awd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AWOD_p920_71 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
pAWOD920:68414..68926
Genome map
AA seq 170 aa AA seqDB search
MMNKLLFSTLFLASMVVNASNISVDMKDLDSGKTVGSILIEQNEYGVVFTPNLSGLPSGL
HGFHIHENNSCDTAEKNGKTILGGAAGGHYDPMKTGRHGFPWSNDNHLGDLPPLYISMNG
NAVQPVLAPRITLPNLSGRSLMIHAGGDNHSDHPKTLGGGGTRLVCGVIK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataaacttttattttctactttatttttagcatcaatggtagtgaacgcatct
aatatttcagttgatatgaaggatttagattcaggtaaaacggtaggctctatattaata
gaacaaaatgaatatggtgttgtttttacacctaatttatcaggattaccaagtggtttg
catggttttcatattcacgaaaataattcatgtgatacagctgaaaaaaatggcaaaacg
attttaggtggagccgctggtggccattatgatccgatgaagactggccgacatggtttt
ccatggtctaacgataatcatttaggtgatttaccaccgttgtatatcagtatgaatggg
aatgctgttcagcctgtattagctcctcgaattacacttcccaacctatctggtcgatct
ttaatgatccatgctggtggcgacaaccattctgatcatcctaaaacgttagggggtgga
ggtactcgtttagtttgcggtgtaattaaataa

DBGET integrated database retrieval system