KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_02565Help
Entry
ERS451415_02565   CDS       T04522                                 

Gene name
glpD_1
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:axx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ERS451415_02565 (glpD_1)
Enzymes [BR:axx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ERS451415_02565 (glpD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(2812143..2813741)
Genome map
AA seq 532 aa AA seqDB search
MNQPLATVTPPDRNRLLAQLDNTPAWDVIVIGGGATGLGTAVDAASRGYRTLLIEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYNLLDQP
FYGVGLKMYDMLAGKLNLSPSRWLSRRETLANAPTLAENVNGRGLKGGVLYYDGQFDDAR
LALSLMRTLFDLGGTAVNYVRATGLTTTGGKVDGVTAEDALGGASFTLRARCVINATGVW
VDSVRRMEDKNAPTMVAPSQGVHLTLPHDFLPGKRAILIPKTDDGRVLFVVPWNGHTIVG
TTDSPRNDLPLDPEAGAEDVDFILNTAARYLSRKPTRDDVTSVWAGLRPLVKATGDASTK
SLSREHTILVSQAGLVTVTGGKWTTYRRMAQDVVDTAIQHQLLTQASCRTESLALHGANG
LAPSQEHAGTPDSYYGSDLATLKALPGAERMLVRSSGLSEAHVRFAARFELARSAEDVLA
RRNRALFLDAEAAMLAAPEVARILAEELGQDAAWQQRTLQELAGVAAHYRLK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaccgctcgccaccgtcaccccgcccgaccgcaaccgcctgctggcgcaactg
gacaacacgcctgcctgggacgtgatcgtcatcggcggcggcgcgaccggcctgggcacc
gccgtcgacgccgccagccgcggctaccgcacgctgctgatcgaggccgccgacttcgcc
aagggcacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcgcaa
ggcaacatcagcctggtgcgcgaggcactgcacgaacgcggcctgctcaaccgcaacgcg
ccacacctggtgtggccgctgggcttcgtggtgccggcctacaacctgctggaccagccg
ttctacggcgtgggcctgaagatgtacgacatgctggccggcaagctcaacctgtcgccc
agccgctggctgtcgcgccgcgagacgctggccaacgcgccgacgctggccgaaaacgtc
aacggccgcggcctgaagggcggcgtgctgtactacgacggccagttcgacgacgcgcgc
ctggcgctgagcctgatgcgcaccctgttcgacctgggcggcacggcggtcaactacgtg
cgcgccaccggcctgaccaccaccggcggcaaggtcgacggcgtcaccgccgaggacgcg
ctgggcggcgccagcttcacgctgcgcgcgcgctgcgtgatcaacgccaccggcgtctgg
gtcgacagcgtgcgccgcatggaagacaagaacgcgcccaccatggtggcgcccagccag
ggcgtgcacctgacgctgccgcacgacttcctgcccggcaagcgcgccatcctgatcccc
aagaccgacgacggccgcgtgctgttcgtggtgccgtggaacggccacaccatcgtcggc
accaccgattcgccgcgcaacgacctgccgctggacccggaagccggcgccgaggacgtc
gacttcatcctgaacaccgccgcgcgctatctcagccgcaagccgacccgcgacgacgtc
accagcgtctgggcgggcctgcggccgctggtcaaggccaccggcgacgcctccaccaag
tcgctgtcgcgcgagcacaccatcctggtgtcgcaggcggggttggtgacggtcacgggc
ggcaagtggaccacctatcgccgcatggcgcaggacgtggtcgacaccgccatccagcac
cagttgctgacgcaggccagctgccgcaccgagtcgctggcgctgcatggcgccaacggc
ctggcgccgtcgcaggaacacgccggcacgccggacagttactacggcagcgacctggcc
acgctcaaggccctgcccggcgccgaacgcatgctggtcaggagcagcggcctgtcggaa
gcgcatgtgcgtttcgccgcgcgcttcgaactggcgcgcagcgccgaggacgtgctggcg
cgccgcaaccgcgcgctgttcctggacgccgaggcggccatgctggccgcgcccgaagtg
gcgcgcatcctggccgaggaactgggccaggatgccgcctggcagcagcgcacgctgcag
gaactggccggcgtggcggcgcactatcggctgaaatga

DBGET integrated database retrieval system