KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_04183Help
Entry
ERS451415_04183   CDS       T04522                                 

Gene name
rlp2
Definition
(GenBank) Ribulose bisphosphate carboxylase-like protein 2
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:axx00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ERS451415_04183 (rlp2)
Enzymes [BR:axx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ERS451415_04183 (rlp2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:4606151..4607428
Genome map
AA seq 425 aa AA seqDB search
MNTQVIRATYLIETPLDPARVAEVMAGEQSCGTFTRVEGETDELRARARAQVESVQELES
ARQASLPNAWLARQPGGMPAVLRRARVRIAFPVANIGPNLPTLAATVGGNLYDLGEVTGL
RLEQLELPSDYRAQFEMPRVGVAGTRQLTGVASGALVGTIIKPNVGLSPEQTAHLVARLC
AAGVDFIKDDEVCANPAHAPLAQRVAAVMAVVRAHRERTGRQVMVAFNITDETDAMRRHA
DLIEREQGSCVMASLNWCGHSAIQTLRRHTPLALHGHRNGYGALSRHPLLGIGFQAYQTL
WRLAGVDHMHVHGLQGKFSQPDAEVVESARDCLAPLTPGIDDAVMPAFSSGQWAGTVPAT
WAAVRTDDLLFMSGGGILAHPDGPAAGVQSIRQAWQAVRAGQDLAAFAAQAPELRRALAH
FGSRA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccaagtcatccgcgccacctacctgatcgaaaccccgctggacccggcgcgc
gtcgccgaggtgatggcgggcgagcagtcctgcggcaccttcacccgcgtcgagggcgag
acagacgagctgcgggcacgcgcccgcgcccaggtcgaatcggtgcaggaactcgaatcc
gcccgccaggccagcctgcccaacgcctggctggcgcgccagccgggcggcatgccggcc
gtgctgcgccgcgcccgcgtgcgcatcgcctttccggtggccaacatcggccccaacctg
ccgaccctggccgccacggtcggcggcaacctgtacgacctgggcgaagtgaccggcctg
cggctggagcagctggaactgccgtccgactaccgcgcgcaattcgagatgccgcgggtc
ggcgtggccggcacgcgccagctgaccggcgtggccagtggcgcgctggtgggcaccatc
atcaagcccaatgtcggcctgtcgcccgagcagaccgcgcacctggtggcgcggctgtgc
gcggccggcgtggatttcatcaaggacgacgaggtctgcgccaaccccgcccatgcgccg
ctggcgcagcgcgtggccgccgtgatggcggtggtgcgggcgcaccgcgaacgcaccggc
cgacaggtgatggtggccttcaacatcaccgacgaaaccgacgccatgcggcgccacgcc
gacctgatcgaacgcgagcaaggcagctgcgtgatggccagcctgaactggtgcggccat
tccgccatccagaccctgcggcgccacacgccgctggcgctgcacggccatcgcaacggt
tacggcgcgctgtcgcgccaccccctgctgggcatcggtttccaggcctaccagacgctg
tggcggctggccggcgtggaccacatgcacgtgcacggcctgcaaggcaagttctcgcag
ccggacgcggaagtggtcgagagcgcgcgcgattgcctggccccgctcacgcccggcatc
gacgacgcggtgatgccggcgttctcgtccggccagtgggccggcacggtgcccgccacc
tgggccgcggtgcgcaccgacgacctgctgttcatgtccggcggcggcatcctggcgcat
ccggacggcccggcggccggcgtgcaaagcatccgccaggcctggcaggcggtgcgcgcc
ggccaggacctggctgccttcgccgcccaggccccggagctgcggcgcgcgctggcgcac
ttcggatcgcgcgcatga

DBGET integrated database retrieval system