KEGG   Azoarcus sp. KH32C: AZKH_0912Help
Entry
AZKH_0912         CDS       T02502                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aza  Azoarcus sp. KH32C
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZKH_0912 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZKH_0912 (ppc)
   00680 Methane metabolism
    AZKH_0912 (ppc)
Enzymes [BR:aza01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AZKH_0912 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(993997..996744)
Genome map
AA seq 915 aa AA seqDB search
MTQDKDAPLREDIRLLGRVLGDTVRDQQGEAMFGLIERIRQTSVRFRRDDDRAARLELEG
ILDALSREQTIQVVRAFSYFSHLANIAEDQHHIRRTRAHLLAGSAPREGSLAHALARALD
GRHTPGELAAFFDTAEVTPVLTAHPTEVQRKSILNCQTDIARLLDQRDRMALTPEERDDS
DETLRSAVLTLWQTRMLRPAKLSVLDEVANGLSYFDSTFLRELPRLYAHLEDQLAERDGA
LGALELPAFLKVGSWIGGDRDGNPFVTAEVLERALALQAGLALGFYLDELHALGARLSLA
LGLVSASDALLALAEHSPDHSPHRNDEPYRRAITGIYARLAATHRALLGIEPPRHPVAAA
EPYASAAELADDLDTIHRSLVANGSAALARGRLRLLRRAVRVFGFHLAPIDLRQNSDVHE
RVVAELLSTARPEVDYRALGEEARCALLLEELATPRPLASPHVHYSEETEGELAIFRAAR
TAHLRFGKAAITNCIISKTDDVSDMLELALLLKEAGLLRPHEQALDVNIIPLFETIDDLA
NAPSVMDRLFSLPGYMSLLGSRGQLQEVMLGYSDSNKDGGFLTSGWSLYKAEIGLVEVFA
RHNVRLRLFHGRGGSVGRGGGPSYQAILAQPGGAVQGQIRLTEQGEVIAAKYGNPEVGRR
NLEVLVAATLEASLLTDRSPAPRADFLDTMQALSDAAFSAYRGLVYETEGFERYFWESTV
ISEIAELNIGSRPASRKKGTRIEDLRAIPWVFSWAQCRLMLPGWFGFGSAVKAWRAANPD
DGLARLQAMYKEWSFFATLLSNMDMVLAKSDLAIASRYAGLVKDAKLREEIFNRIRTEWQ
DTVDALLAITGQTELLDDNPLLKRSIRNRFPYLDPLNHVQVELLRRHRESHEDARIRLGI
HLSINGIAAGLRNSG
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagacaaggacgcgccgctgcgcgaagacatccgactcctcggccgcgtgctc
ggcgacaccgtgcgcgaccagcaaggcgaagcgatgttcggcctgatcgaacgcatccgc
cagacctcggtccgcttccgccgcgacgacgaccgcgccgcacgtctcgaactcgaaggc
atcctcgacgccctgtcgcgcgagcagacgatccaggtcgtgcgtgccttcagctatttc
tcccacctcgcgaacatcgccgaggaccagcaccacattcgccgcacgcgcgctcacctc
ctcgccggctcggcgccgcgcgaaggcagcctcgcccacgccctcgcccgggcgctcgac
ggacgccacacgccgggcgaactcgccgccttcttcgacaccgccgaggtcacccccgtc
ctgacggcgcacccgaccgaagtgcagaggaagagcatcctcaactgccagaccgacatc
gcgcgcctcctcgaccagcgcgaccgcatggcgctgacgcccgaagaacgcgacgacagc
gacgagacgctgcgcagcgcggtgctgacgctgtggcagacgcgcatgctgcgccccgcg
aagctgtcggtgctcgacgaagtggcgaacggcctgtcgtacttcgacagcaccttcctg
cgcgaactgccgcgcctctacgcccacctcgaagaccagctcgccgaacgcgacggggcc
ttgggcgcactggaattgcctgccttcctgaaagtcggcagctggatcggcggcgaccgc
gacggcaatcccttcgtcaccgccgaagtcctcgaacgcgcgctcgcgctgcaggccggc
ctcgcgctcggcttctatctcgacgaattgcacgcactgggcgcccgcctgtcgctcgca
ctgggcctcgtcagcgcctccgacgcactgctcgcgctcgccgagcactcgcccgaccac
tccccgcatcggaacgacgaaccctatcggcgcgcgatcaccggcatctacgcgcgcctt
gcggcaacccatcgggcactcctcggcatcgaaccgccgcgccacccggtcgccgcagcc
gaaccctacgcgagcgctgccgaactcgctgacgaccttgacacgatccatcgctcgctc
gtcgcgaacggctcggccgcgctcgcccgcggccgcctgcgcctcctgcgccgcgcggtg
cgcgtcttcggcttccacctcgcgccgatcgacctgcgtcagaactccgacgtgcacgag
cgcgtcgtcgccgagctcctgtcgacggcacgccccgaggtcgactaccgcgccctcggc
gaagaggcccgctgcgcgctgctgctcgaagagctcgcgacgccgcgccccctcgcttcg
ccgcacgtgcattactcggaagagaccgaaggcgaactcgcgatcttccgcgccgcgcgc
accgcgcacctgcgcttcggcaaggccgcgatcacgaactgcatcatctccaagaccgac
gacgtctcggacatgctggagctcgcgctgctgctgaaggaagcgggcctcttgcgaccg
catgagcaagcgctcgacgtgaacatcatccccctcttcgagaccatcgatgacctcgcc
aacgccccgtcggtgatggaccggctgttctcgcttcccggctacatgagcctcctcggc
tcgcgcggccagctgcaggaggtgatgctcggctactccgacagcaacaaggacggcggc
ttcctgacctcgggctggtcgctgtacaaggccgaaatcggcctcgtcgaagtcttcgcg
cgccacaacgtgcgcctgcggctcttccacggccgcggcggctcggtcggccgcggcggc
gggccgagctaccaggcgatcctcgcccagccgggcggcgccgtgcaggggcagatccgg
ctcaccgaacagggcgaagtcatcgcggcaaaatatggcaacccggaagtcggccgccgc
aacctcgaagtcctggtcgccgcgaccctcgaagcgagcctgctgaccgaccgctcaccg
gccccgcgcgccgacttcctcgacacgatgcaggcactctcggacgcggcgttctccgcc
taccgcggcctcgtctacgagaccgaaggcttcgagcgctacttctgggaatcgaccgtg
atctccgagatcgccgaactcaacatcggctcgcgccccgcctcgcgcaagaagggcacg
cgcatcgaggacctgcgcgcgattccctgggtattcagctgggcgcaatgccgactgatg
ctgcccggctggttcggcttcggctcggcggtcaaggcctggcgcgcagcaaacccggac
gacggcctcgcgcggctgcaggcgatgtacaaggaatggtccttcttcgcgacgctgctg
tcgaacatggacatggtgctcgcgaagtccgacctcgcgatcgcgtcgcgctacgcaggc
ttggtaaaagacgcgaagctgcgcgaggagatcttcaaccgcatccgcacggaatggcag
gacacggtcgacgccctgctcgcgatcaccggccagaccgaactcctcgacgacaacccc
ctactgaagcgctccatccgcaaccgcttcccctacctcgacccgctcaaccacgtgcag
gtcgaactgctgcgccgtcaccgcgaaagccacgaagacgcgcgcatccggctagggatc
cacctctcgatcaacgggatcgcggcgggcctgcgcaacagcggctaa

DBGET integrated database retrieval system