KEGG   Azoarcus sp. KH32C: AZKH_1499Help
Entry
AZKH_1499         CDS       T02502                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
aza  Azoarcus sp. KH32C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1671727..1674486)
Genome map
AA seq 919 aa AA seqDB search
MLRIVRELVTELHPDRDDVPGLDSHLERDLGLDSLARVELLARLERAAQAQLPADTLGTA
ETPRDLLVALHAARPELAARAADIVLPATGQTTIEAPAAAGTLIDVLDWHAARSPGHVHI
RLLRGDAEAATLTHRDLLDGARRIAGGLRQAGLAPGDAVAIMLPTTLDFFTSFFGALLAG
GVPVPMYPPTRPSQLEDHLRRQAGILDSCRAPVLITDADVRTVGRLLATQSASLKRVATA
EELARADAPSATATPRPEDLALLQYTSGSTGNPKGVMLTHANLLANIRAWSRRIGMNAAD
VTVSWLPLYHDMGLIAAWLGSLYNGSALVLMSPLDFLSRPARWLWTIHRYRGSLSAGPNF
AYELVLKHVEDRELAGLDLSCWRIAANGAEPVSPDTVERFAERLAPYGLRRDAMTPSYGL
AENTVGLAVPRPGRGPRIDRVDRETFFRGTGATAAADNDASAIRFVGCGQPLPGHELRIV
DGAGTELPERRVGRIEFRGPSATAGYLRNPDETRKLWHEGWLDTGDLGYLAGGELFVTGR
VKDMIIRGGRNLYPYELEEAIGAQPHVRKGCVAIFGSPDPATAGERLVAVVETRTQDDDE
RRRLRHAIDRLAVDLLGVPLDEVVLAPPHSVLKTSSGKIRRAATRDLYRSGALGRPRSVR
MQLLRLAAMAAGGRAARFLRRGVAALWAAWSWTALVLLAIPVWLAVTALHRPALAWRIAR
HGTRLLAAITGIRITVRGLENLPSTAPCIAVANHSSYLDGLVAAAALPRPFSFVAKRELL
DNPVAGRFLRGLGAEFIERFALQDSVDAARRLAQCARAGASLFYFPEGTFIRRAGLQEFR
LGAFLAACESDLPVLPLTISGTRAVLPDETWFPRRGPITVTIGRPVLPPGSDWSAAVALR
DTVRKEILAHCGEPDATTL
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcgcatcgtgcgcgagctcgtgaccgagttgcaccccgaccgtgacgacgtgccc
ggcctcgacagtcacctcgaacgcgacctcggcctcgatagtctcgcgcgcgtcgaactg
ctggcgcggctcgaacgcgcggcgcaggcgcaattgcccgccgacaccctcggcaccgcc
gaaaccccgcgcgacctgctcgtcgcgctgcacgccgcgcggccggagctggccgcacgg
gcggcggacatcgtgttgcccgcaacagggcagacgacgatcgaagccccggccgcggcc
ggcacgctcatcgacgtcctggactggcacgccgcgcgctcgcccggacacgtccacatc
cgcctgctgcggggcgacgccgaggccgccacgctgacccaccgcgatctgctcgacggc
gcgcggcgcatcgccggcggtctccgccaggccgggctcgcgccgggcgacgcggtcgcg
atcatgctgccgacgacgctcgacttcttcacgagcttcttcggagccctgctcgccggc
ggcgtgccggtgccgatgtatccgccgacccgcccctcccagctcgaggaccatctgcgc
cgtcaggccggcatcctcgacagttgccgcgctccggtgctgatcaccgacgccgatgtg
cgcaccgtcgggcgcctgctcgcgacgcagagcgcgagcctgaagcgcgtcgccaccgcc
gaggagctggcccgcgccgacgccccgtccgcgaccgccacgccacgccccgaagacctc
gccctgctgcaatacacctcgggcagcaccggcaaccccaaaggcgtgatgctcacgcac
gccaacctgctcgcgaacatccgcgcctggagccgccggatcggcatgaacgccgccgac
gtcaccgtgagctggctgccgctgtaccacgacatggggttgatcgcggcgtggctcggc
agcctctacaacggctccgcgctcgtgctaatgtcgccgctcgacttcctgtcgcgtccc
gcgcgatggctatggaccatccaccgctaccgcggcagcctctcggccggcccgaacttc
gcctacgaactcgtgctcaagcacgtcgaggaccgggagcttgccggactcgacctgtcg
tgctggcgcatcgccgcgaacggtgccgagcccgtgagtcccgacaccgtcgagcgcttt
gccgaacggctcgcgccctacggcctgcggcgcgacgccatgaccccctcgtacgggctc
gccgagaacaccgtcggcctcgccgtcccccgccccggacgcggcccccgcatcgaccgc
gtcgatcgcgaaaccttcttccgcggcaccggcgcgaccgctgccgccgacaacgacgcc
agcgcgatccgcttcgtcggctgcggccagcccctgcccgggcacgagttgcgcatcgtc
gatggggccggcacggaactgcccgaacgccgcgtcggccgcatcgaattccgcggcccg
tccgccaccgcgggctacctgcgcaatccggacgaaacccgcaagctgtggcacgagggc
tggctcgacaccggcgacctcggctacctcgcgggcggcgagctcttcgtcaccgggcgc
gtcaaggacatgatcatccgcggcgggcgcaacctctacccgtacgaactcgaagaggcg
atcggcgcgcagccgcacgtgcgcaagggctgcgtcgccatcttcggcagccccgacccg
gccaccgccggcgaacgcctcgtcgcggtcgtcgagacccgcacgcaggacgacgacgaa
cggcgccggctgcgccacgcgatcgaccgcctcgccgtcgacctgctcggcgtgccgctc
gacgaagtcgtgctcgccccgccgcacagcgtgctcaagacctccagcggcaagatccgc
cgcgccgcgacgcgcgacctgtaccggagcggcgcgctgggtcgcccgcgcagcgtgcgc
atgcaactgctgcgccttgccgccatggcagccggtggccgcgcggcgcgtttcctccgg
cgcggcgtcgcggccttgtgggccgcatggtcgtggacggcgctggtgctgctcgcgatc
ccggtatggctcgcggtgaccgcgctgcaccggcctgcgctcgcgtggcgcatcgcccgc
cacggcacacgcctgctcgcagccatcaccggcatccgcatcaccgtccggggcctcgaa
aatctcccctcgaccgccccctgcatcgccgtcgcgaaccactcgagctacctcgacgga
ctcgtcgccgccgccgcgctgccgcgccccttcagcttcgtcgcgaaacgcgaactgctc
gacaacccggtcgcaggacgtttcctgcgaggactcggcgccgagttcatcgaacgcttc
gcgctgcaggacagcgtcgacgccgcccgccgcctcgcccaatgcgcgcgtgccggcgcg
tcgctgttctacttcccggaaggcactttcatccggcgtgccggcctgcaggaattccgc
ctcggggccttcctcgccgcctgcgagtccgaccttcccgtgctgccgctgacgatcagc
ggcacccgcgcggtcctccccgacgagacctggtttccgcgccgcggcccgatcaccgtc
accatcggccgccccgtcctgccgccgggttcggactggagcgcggccgtcgcgctgcgc
gacacggtgaggaaggagatcctggcgcactgcggagaaccggacgcaacgaccctctag

DBGET integrated database retrieval system