KEGG   Azorhizobium caulinodans: AZC_1006Help
Entry
AZC_1006          CDS       T00609                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:azc00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AZC_1006
Enzymes [BR:azc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AZC_1006
DNA repair and recombination proteins [BR:azc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AZC_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
1126636..1129338
Genome map
AA seq 900 aa AA seqDB search
MGLSTYRAKRDFTVTPEPDGGAKGKARAAASASAGAYVIQKHAARRLHYDLRLEMDGVLK
SWAVTRGPSLVPGEKRLAVHVEDHPLAYGGFEGTIPEGQYGAGKVIVWDRGSWTPVGDPH
KGYKKGHLEFALDGEKLHGRWHLVRMSPHPGDKKENWLLIKVEDEAARPEGAPEITDEAP
LSVVSGRDVEEVGAPSAAKSPKLSTAKTSRPKAAARDAKASEEAETTASGAERGARAVSA
PAKAKKTTAARVNGRSTRATAWDLPKGAKRAPLPDFLPPALATLARQAPKGRRYVHEIKF
DGYRIAARLEDGEVRLLTRTGLDWSARFGTAIREAAAALPVSDAMLDGEVVVEGGNGASD
FSALQADLSEGRTDRFVYYAFDLLHLDGHDLTGAPLAERKALLEQLLTRAEGSGEGVLRY
SGHFEDDGAMVLQHACRLSLEGVVSKLKDAPYHSGRSRDWIKSKCSERQEFVIGGFVPST
TARKAIGSLVLGVYEGKRLVHVGRVGTGFSNKMASDLHTLLAPEAVEESPFSARLTADEA
RGVTFVAPKRVAEVEFRAWTGDGHLRHAAFRGLRDDKAAADVVREAASQPAETPKTPPKR
RVRLTHPDRIYWPDAGVTKEGLADYYAEVWPRIAPFIVGRPLALVRCPEGIEGQHFFQKH
PWKGADKALKEVHDPKAPDEPPYLAVETLDGLMALVQGAALEIHPFGAPLSDWERPDLLT
MDLDPGEGVPWSAVIAAAHEVKARLETAGLAAFVKTSGGKGLHVCAPLKPRADWTELKAF
TKAMAETMAQEAPDTYVATITKAKRRGRILVDYLRNQRGSTAVAPYSARARAGAPVSMPI
AWEELGEGMGPQHFTVLNAPARLANLSADPWADFRKAAAPLPAGRTAGGTAGGKRRGGRR
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcagcacctatcgcgccaagcgcgacttcaccgtgactcccgagcccgacggc
ggcgcgaaaggcaaggcccgcgccgcagccagcgcctcggcgggcgcctatgtgatccag
aagcacgccgcccgccgcctgcactatgatctgcggctggagatggatggcgtgctgaag
agctgggccgtcacgcgcgggccgagcctcgtgcccggtgagaagcgcctcgccgtgcat
gtggaggaccatccgctcgcctatggcggcttcgagggtaccatccccgagggccagtac
ggggcgggcaaggtcatcgtctgggatcgcggcagctggaccccggtgggggatccgcac
aagggctacaagaaggggcatctggaattcgcactcgacggcgaaaagctccatggccgc
tggcatctggtgcgcatgtcaccccaccccggcgacaagaaggaaaactggctgctcatc
aaggtggaggacgaggcggcgcgccctgagggtgcgcccgagattaccgacgaggcgccc
ctctccgtcgtctcgggccgggacgttgaggaagtgggtgccccatcggccgcaaagtcc
ccgaagttaagcacggcaaagacgtccaggccgaaggctgcggcacgcgatgcgaaggca
tccgaggaggccgagacgaccgcaagcggcgcggagcggggtgcgcgcgcagtgtctgct
ccggcaaaagccaagaaaacgacggccgcaagggtcaacggacgctccacccgcgcgacc
gcctgggacctgccaaagggcgcgaaacgcgcgcctttgccggatttcctgcccccggct
ctcgccacgctggccaggcaggcgccgaagggccggcgctatgtccatgagatcaagttc
gatggctatcgcatcgccgcgcggcttgaggatggagaggtccgcctgcttacgcgcacc
ggcctcgactggtccgcgcgcttcgggacggcgatccgggaggcggccgcggcccttccc
gtatccgatgccatgcttgatggcgaggtggtggtggagggcggcaacggcgcctcggac
ttctccgccttgcaggcggatctgagcgaagggcgcacggaccgcttcgtctattatgcc
ttcgatctcctgcatctcgacgggcacgacctgacgggcgcgccgctcgcggagcgcaag
gcgctgctggagcaattgctcaccagagctgaagggagcggcgaaggcgtcctgcgctac
agcggccatttcgaggatgacggcgccatggtgctccagcatgcctgccggctgagcctg
gagggcgtcgtctccaagctcaaggatgcgccctatcattccggccgctcgcgggactgg
atcaagtccaagtgctcggagcggcaggagttcgtgatcggcggcttcgtgccctccacc
actgcccgcaaggctatcggctcgctggtgctcggcgtctatgagggcaagcgcctcgtc
catgtggggcgtgtgggcacgggcttctcgaacaagatggcgtcggatctccacaccctg
ctggcgcccgaggcggttgaggaaagtccgttttccgcgcggcttacggcggatgaggcg
cggggcgtcacctttgttgcgcccaagcgtgtggccgaagtcgagttccgcgcctggacg
ggagacggccacctgcgccacgccgccttccggggactgcgcgacgacaaggcggccgcc
gatgtggtgcgcgaggccgcgtcgcagccggccgagacgcccaagacaccgcccaagcgc
cgggtgcgcctcacccatcctgaccgcatctactggccggatgcgggcgtcaccaaggag
ggattggccgattattacgcagaggtctggccgcgcatcgcgccctttatcgtcggccgg
ccgctggcgctggtgcgttgtccggagggcatcgaagggcagcacttcttccagaagcac
ccgtggaagggcgcggacaaggcgctgaaggaggtgcacgatcccaaggccccggacgag
ccgccctatctcgccgtcgagacgctggacgggctgatggcgctggtgcagggggcggcg
ctggaaatccaccccttcggtgctccgctctcggactgggagcgcccggaccttctcacc
atggatctcgaccccggcgagggcgtcccatggagcgcggtcatcgccgctgcccatgag
gtgaaggcgcgccttgagacggcgggccttgccgccttcgtgaagacctccggcggcaag
gggctgcatgtctgcgcgccgctgaagccgcgggccgattggaccgaactcaaggccttc
accaaggccatggccgagacaatggcgcaggaggcgcccgacacctatgtggcgaccatc
accaaggccaagcggcgtggccgcatccttgttgattatctgcgcaaccagcgcggctcc
acggcggtcgcgccctattccgcccgcgcgcgggccggggcgcccgtctccatgcccatc
gcttgggaggagctgggcgagggcatggggccccagcatttcacggttctgaacgcaccg
gcgcggctcgccaatctctcggccgatccatgggctgatttccggaaggcggcggcgccc
ctgccggcgggcagaacggcgggcggaacggccggcggcaaacggcgcggcgggaggcgc
tga

DBGET integrated database retrieval system