KEGG   Azoarcus sp. CIB: AzCIB_1011Help
Entry
AzCIB_1011        CDS       T04019                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
azi  Azoarcus sp. CIB
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1133964..1136750)
Genome map
AA seq 928 aa AA seqDB search
MNRSRPAIDAAEVLGIVRGLVSELRPGKPPEAGLDSHLERDLGLDSLARVELLARIERAA
RVRLPEDTLATADTPRQLFAALRAARPEATASAPEIAAAPDTARIETPVGASTLVEVLLW
HAERSPEHVHVRLLHDDAEVGTLTHRELLQGAQRIAAGLQQRGIAPGDAVAIMLPTSLEF
FTSFFGALLAGGVPVPMYPPTRPSQLEDHLRRQSGILESCRAQVLITDAQVQPVARLIST
PSGHLRHTVTARELSTGGGSPAAATPRADDLALLQYTSGSTGNPKGVMLTHANLLANIRA
WSRSVAITAADVTVSWLPLYHDMGLIAAWLGSLYNGCPLVLMSPLDFLSRPVRWLRALHR
YRGTLSAAPNFAYELVLKHVEEPELAGLDLSHWRIAANGAEPVNPDTLEHFAERLAPYGL
HRETMTPAYGLAENAVGLAVPPPGRGPRIDRVAREAFFRTEAVRAAAEDAGAIRFVGCGQ
PLPGHEVRIVGQNGDELPDRHVGRIEFRGPSATAGYLRNPEETRKLLRAGWLDTGDLGYL
AEGELFVTGRVKDMIIRGGRNLYPYELEDAIGALAGVRRGCVAVFGVADPATASERLVAV
VETRSADDVERRRLEHAVGNLAVDLLGVPLDEVVLAPPHSVLKTSSGKIRRAATRELYQS
GVLGRQHSVRMQMLRLAALAARRNATHAVQRTGATLWAAWAWTALVLLAIPVWLAVAGLR
RPALGWHIGRGGARLLAGLIGVRIDVKGQANLPASAPCIVVANHASYLDGLIAAAALPRP
FVFVAKRELLDNAIARRFLLGLGTEFIERFAVQDSADAAKRLAERARLGAALFYFPEGTF
VRRPGLQEFRLGAFLAACEADLPVVPVTIRGTRAVLPDETWRPRRGPVTVTIGRPILPQG
KDWSAALALRDAARRDILQRCGEPDATV
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaagccgtccggcaatcgacgcggccgaggtgctcgggatcgtgcgcgggctc
gtcagcgagctgcgccccggcaagccgccggaagccggtctcgacagccacctcgaacgc
gacctcggactcgacagcctcgcgcgcgtcgagttgctcgcgcgcatcgaacgcgccgcg
cgtgtgcgcctgccggaagacaccctcgccacggcggacaccccgcgccagctctttgcc
gcgctgcgcgccgcacgaccggaggcgaccgcgtccgcgcccgagatcgccgctgcgccg
gacaccgcgcgcatcgagaccccggtcggtgcatccacactcgtcgaggtgctgctgtgg
cacgcggagcgttcgcccgagcatgtgcatgtccgcctgctgcacgacgacgccgaggtc
ggcacgctcacgcaccgcgagctgctgcagggggcgcagcgcatcgccgccgggctgcag
cagcgcggcatcgcgccgggcgacgcggtggcgatcatgctgccgacctcgctggaattc
ttcacgagcttcttcggcgccctgctcgcgggcggcgtgccggtgccgatgtacccgccc
acgcgcccctcccagctcgaggaccacctgcgccgccagtccggcattctggagagctgc
cgcgcgcaggtgctgatcaccgacgcgcaagtgcagccggtcgcccgcctgatctccacg
ccctcggggcacctcaggcacaccgtcaccgcacgcgagctctccacaggcggcggcagt
cccgcagcagcaacgccgcgggcggatgacctcgcgctgctgcaatacacctcgggcagc
accggcaaccccaagggcgtgatgctcacgcacgcgaacctgctcgccaacatccgcgcg
tggagccgcagcgtcgccatcacggcggcggacgtcacggtgagctggctgccgctgtac
cacgacatgggcctgatcgccgcctggctgggcagcctgtacaacggctgcccgctcgtg
ctgatgtcgccgctggatttcctgtcgcgcccggtgcgttggctgcgcgccctgcaccgc
taccgcggcacgctctcggccgcaccgaacttcgcctacgagctcgtgctgaagcatgtc
gaggaacccgaactcgccggtctggatctctcgcactggcgcatcgccgcgaacggcgcc
gagcccgtgaacccggacacgctggaacactttgccgaacgcctcgcgccctacggcctg
caccgcgagacgatgacccccgcctacggcctcgccgagaacgccgtcggtctcgccgtg
ccgccacccggacgcggtccgcgcatcgatcgcgtcgcacgcgaagccttcttccgcacc
gaggcggtccgtgccgccgcggaggacgcgggcgcgatccgcttcgtcggctgcggccag
ccgctgcccggccatgaagtgcgcatcgtcgggcagaacggcgacgaactccccgaccgc
cacgtcggccgcatcgaattccgcggcccgtcggcgaccgccggctacctgcgcaatccc
gaggagacgcgcaagctgctgcgcgccggctggctggacaccggcgacctcggctacctc
gcggaaggcgagctcttcgtcacaggtcgcgtcaaggacatgatcatccgcggcggacgc
aacctgtacccctacgaactggaagatgcgatcggcgcactggccggcgtgcgccgcggc
tgcgtcgcggtgttcggggtcgccgatcccgcaacggcgagcgagcgcctggtcgccgtc
gtcgagacccgcagcgccgacgatgtcgaacgccgccggctcgaacatgcggtcggcaac
ctcgcggtcgacctgctcggcgtgccgctcgacgaggtcgtgctcgcaccgccgcacagc
gtactgaagacgtccagcggcaagatccggcgcgccgcgacgcgcgagctgtaccagagc
ggcgtgctaggccgccagcacagcgtgcgcatgcagatgctgcgactcgccgcgctcgcc
gcccgccgcaacgcaacccatgccgtgcaacgcacgggcgccacgctgtgggccgcctgg
gcgtggacggcgctggtgctgctcgcgatccccgtctggctcgccgtcgcagggctgcgc
cgcccagccctcggctggcacatcggccgcggcggcgcgcgcctgctggccggcctgatc
ggcgtccgcatcgacgtcaagggacaagcgaaccttcccgcatccgccccctgcatcgtc
gtcgccaatcacgcgagctacctcgacggcctgatcgccgccgcggcgctgccccgcccc
ttcgtcttcgtcgccaagcgcgagctgctcgacaacgcgatcgcgcgccgcttcctgctg
ggcctgggaacggagttcatcgaacgtttcgcggtgcaggacagcgcggacgccgcaaag
cggctcgccgaacgcgcacggctgggcgccgcgctgttctactttcccgaaggcaccttc
gtgcgacggcccggcctgcaggagttccgcctcggcgccttcctcgctgcatgcgaggcc
gacctccccgtcgtgccggtcacgatccgcggcacgcgcgcggtgctgcccgacgagacc
tggcggccgcgccgcggccccgtcaccgtgacgatcggccgccccatcctgccgcagggc
aaggactggagcgccgcgctcgcgctgcgcgatgccgcccgtcgggacatcctccagcgc
tgcggcgagccagacgcgacggtctga

DBGET integrated database retrieval system