KEGG   Azoarcus sp. BH72: azo2267Help
Entry
azo2267           CDS       T00441                                 

Gene name
gstB
Definition
(GenBank) putative glutathione transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
azo  Azoarcus sp. BH72
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:azo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    azo2267 (gstB)
Enzymes [BR:azo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     azo2267 (gstB)
Transporters [BR:azo02000]
 Other Transporters
  Pores ion channels [TC:1]
   azo2267 (gstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(2483290..2483919)
Genome map
AA seq 209 aa AA seqDB search
MNELVLYTHPYSRGRIAHWMLEEVGQPHRIEWAEFGPAMKTPEFLALNPMGKVPVLTHGD
VVVTEAAAICAYLADRFPDSGLAPVAHDSARGPWYRWLFFAAGPVEQAVTAHSMGWQVPE
GKDAFVGFGSYARVLDTLEKAVSAAPYLCGEFSAADVYVGSHLGWGMMFGSIEKRPAFEE
YVARLQARPAAQRADRINAERIEAMQKKA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaactggttctatacacccatccctattcgcgcggacgcatcgctcactggatg
ctggaagaggtcgggcagccacaccgcatcgagtgggccgagttcggcccggcgatgaag
acgccggagttcctggcgctcaatcccatggggaaggtgccggtgctgacccacggtgat
gtggtcgtcaccgaggcggcggcgatctgcgcctacctcgccgaccgctttccggatagc
ggcctggcgccggtcgcgcatgactccgcgcgcggcccctggtaccgctggctgttcttc
gccgcggggccggtggagcaggcggtgaccgcgcattcgatgggctggcaagtgccggag
ggcaaggatgccttcgtcggcttcggcagctacgcgcgcgtgctcgacacgctggagaag
gccgtctcggcggcgccgtacctgtgcggcgagttcagcgcggccgatgtgtacgtcggt
tcccacctcggctgggggatgatgttcggcagcatcgagaagcgcccggcgttcgaggaa
tacgtcgccaggctgcaggcgcggccggcggcacagcgcgccgaccgcatcaacgccgag
cgcatcgaagccatgcagaagaaggcctga

DBGET integrated database retrieval system