KEGG   Brucella abortus A13334: BAA13334_I02057Help
Entry
BAA13334_I02057   CDS       T01704                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
baa  Brucella abortus A13334
Pathway
baa00730  Thiamine metabolism
baa00790  Folate biosynthesis
baa01100  Metabolic pathways
baa02020  Two-component system
Module
baa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:baa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BAA13334_I02057
   00790 Folate biosynthesis
    BAA13334_I02057
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAA13334_I02057
Enzymes [BR:baa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BAA13334_I02057
Exosome [BR:baa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAA13334_I02057
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:baa00537]
 Enzymes
  BAA13334_I02057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase DUF5300
Motif
Other DBs
NCBI-ProteinID: AEW17647
LinkDB All DBs
Position
1:complement(1223027..1224394)
Genome map
AA seq 455 aa AA seqDB search
MAQSETAAPLFQRSAKGDLSAAGGARRLDGDITAAFRDQIRKGPARNVILLIGDGMGDSE
ITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDKESGKPNYVTDSAASGTAWTTGVKTYN
GAIGVDIHGKPHKTLIELAKEKGLGTGNVSTAELQDATPAVQVAHVTHRKCYDPTSTAEK
CKDNALENGGPGSISEQLLNTRPDVTLGGGAKYFEDKARAGTWKGQTLSAQAEARGYQLV
RNADALSKVETANQDKPVLGLFSPGNMPVRWKGPQAAHHGNLDREPVKCKVNEKRTADIP
TLAQMTEKAIDLLKTNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQAALDFAR
KDGNTLVIVTADHAHASQIIDPDAKAPGLSQALKTEDGAIMGVTYGNSDEADDQGHTGAQ
LRIAAFGPGAANFTGLTDQTDMFYTIRDALQLQAE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtctgaaactgcggctccactcttccagcgcagcgcaaaaggcgacctgtcg
gcagcaggcggcgcacgccgccttgatggtgatattaccgcagcttttcgcgatcagatc
aggaaggggcctgccagaaacgtcatcctgctgatcggagacggcatgggcgattccgag
atcacggttgcgcgcaattatgcagtcggcgcaggcaatcatttcaagggcatcgatgcc
cttcccgttaccggccagtacacccattattcgctcgacaaggaaagcggcaagccgaat
tacgtgactgattctgccgcctccggcaccgcctggaccactggcgtcaaaacctataac
ggcgccatcggcgtcgatattcatggcaaaccgcacaaaacgctcattgaactcgccaag
gaaaagggcctcggcaccggcaatgtcagcactgccgaattgcaggatgccacacccgcc
gtgcaggttgcccatgttacccatcgcaagtgctacgacccaaccagcacggcggaaaag
tgcaaggataatgcgcttgaaaatggcggcccaggctcgatcagcgaacagcttttgaac
acccgcccggacgtgacattgggcggcggcgcaaaatatttcgaggacaaggcccgggct
ggcacatggaaaggccagaccttgagcgcacaggccgaagcacgcggctatcaactggtt
agaaatgccgacgcattgagcaaggtcgagacagccaatcaggacaaacctgttctcggc
ctcttctcaccgggcaacatgccggtccgctggaaagggcctcaggccgcccatcacggc
aatctcgacagagagcctgtcaagtgcaaggtcaatgagaagcgcactgccgatattccg
acactggcgcaaatgaccgagaaagccatcgacctgctgaaaaccaacgaaaaaggcttt
ttccttcaggtggaaggtgcctccatcgacaaacaggaccatgccgccaatccgtgcggg
cagatcggcgaaacagtcgatctggatgaagccgtgcaggccgcactcgattttgcccgc
aaagacggcaacacgcttgtcatcgtaacggccgatcacgcccatgcaagccagatcatt
gatcccgatgcgaaggccccgggtttgagccaggcattgaaaaccgaggatggcgcgatc
atgggcgtgacctatggcaattccgacgaagccgacgatcagggccacacaggcgcgcaa
ttgcgcatagccgcctttggccccggcgctgccaattttaccggcctcacggatcagacg
gatatgttctacacgatccgcgatgccttgcagttgcaggcggaataa

DBGET integrated database retrieval system