KEGG   Brucella abortus bv. 9 C68: DK53_583Help
Entry
DK53_583          CDS       T03474                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase Mn
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
babu  Brucella abortus bv. 9 C68
Brite
Enzymes [BR:babu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DK53_583 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:594959..595558
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSFEEIVKES
FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA
GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLVNWDYVLEMYEKAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaactgcccgcccttccgtatgactatgatgcgcttgcgcctttcatgtcg
cgcgaaacgcttgaatatcatcacgacaagcatcatcaggcctatgttaccaacggtaac
aagcttctcgaaggttccggcctggaaggcaagagcttcgaagaaatcgtcaaggaaagc
ttcggcaagaatcaggccctcttcaacaatgccggccagcactacaaccatatccatttc
tggaaatggatgaagaaggatggcggcggcaagaaactgccgggcaagctggaaaaggcc
tttgattccgatcttggcggttatgacaagttccgcgctgatttcatcgctgccggtgcc
ggccagttcggttcgggctgggcctggctttccgtcaaggacggcaagcttgaaatttcc
aagaccccgaacggtgaaaacccgctcgtgcacggtgcggcgccgatcctcggcgtggat
gtgtgggaacactcctattacatcgattaccgcaacgcgcgtccgaaatatctcgaagct
ttcgtcgatagcctcgtgaactgggattacgtgctggaaatgtacgaaaaggcggcataa

DBGET integrated database retrieval system