KEGG   Burkholderia ambifaria MC40-6: BamMC406_3744Help
Entry
BamMC406_3744     CDS       T00684                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BamMC406_3744
Enzymes [BR:bac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BamMC406_3744
Transporters [BR:bac02000]
 Other Transporters
  Pores ion channels [TC:1]
   BamMC406_3744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2:complement(715404..716072)
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELDVPYEIVRYARDPKTMLAPPALRAIHPLGKSPVVTDDG
RTIAESGAIIEYLVERHGNGRLAPPGGTPERHDYTYWLHYAEGSAMPPLLLKLVALRIAH
APMPFFARPIARKIAATLQAGFVDPQIALHLDHIDGALKRTGWFVGDSFSAADIQMSFPL
EAAMARGDGGRYPAIARFLDTIHARPAYRRALERGGPYELLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccatcacctgaacaactcgcgttcgcagcgcgtgctctggctactcgaa
gaactggatgtgccgtacgagatcgtgcgctacgcgcgggatccgaagacgatgctcgcg
ccgcccgcgctgcgcgcgatccatccgctcggcaagtcgcccgtcgtcaccgacgacggc
cgcacgatcgccgaatcgggcgcgatcatcgagtacctggtcgaacgccacggcaacggc
cgcctcgcgccgcccggcggcacgcccgagcggcacgactacacgtactggctgcactac
gcggaagggtcggcgatgccgccgctgctgctgaagctcgtcgcgttgcggatcgcgcat
gcgccgatgccgttcttcgcgcggccgatcgcgcgcaagatcgccgcgacgctgcaagcg
ggcttcgtcgatccgcagatcgcgctgcatctcgatcatatcgacggcgcgctgaagcgc
acgggctggttcgtcggcgacagcttcagcgcggccgacatccagatgagcttcccgctc
gaggctgcgatggcgcgcggcgacggcggcaggtatccggcgatcgcacgctttctcgac
acgatccacgcgcggcctgcataccgccgcgcgctcgagcgcggcggtccgtacgaactc
ctcaaataa

DBGET integrated database retrieval system