KEGG   Burkholderia ambifaria MC40-6: BamMC406_5257Help
Entry
BamMC406_5257     CDS       T00684                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BamMC406_5257
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BamMC406_5257
Enzymes [BR:bac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BamMC406_5257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2:2466372..2467649
Genome map
AA seq 425 aa AA seqDB search
MVEIPHRRSEFTARYFVESSVPIAKAAEVIAGEQSSGTFLALPGETDALKNRARARVVKV
DSHSPVLEPSLYSAHVERKGSPSVYFRGEIEIAFPVDNIGPNLPTLLSTVAGNLFELGEV
TGLRLLDIDLPATYAAQFPGPQFGISGTRDFAKVYDRPMIGTIIKPSIGLLPAQTAEIVD
SLCAADIDFIKDDELLADPTYASFDERLAAVMPVLHRHADRMGRMPMYAINISGTIDEML
QRHDAVVRAGGTCVMICINWVGFAGVEHLRKHAQLPIHGHRNGWGALTRYPQLGFSFKAY
QKLWRLAGVDQLHVNGIRSKFWEPDASVIESARACLTPFAGVQPLMPVFSSGQWASQAPD
LYAQLGSVDLMHLAGGGIIGHPHGIAAGVASMREGWEAAVEGIDLNTFAESRPALRAALS
HFQSA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaatcccccatcgaagatccgaattcactgcgcgctatttcgtcgagagttca
gtaccgattgcaaaagccgcagaggtaatcgcaggcgaacagtccagcgggacgtttctt
gcgctgcccggggagactgatgcgctgaagaaccgtgccagggcccgtgtagtgaaggtg
gattcgcactctcctgttctggagccctccctgtacagtgctcatgtcgaacgcaaggga
tccccgagtgtctatttccggggtgagatcgagatcgcctttccggtcgacaacattggt
cctaacttgccgaccctcctgtcaacggtcgcgggtaatctgtttgagttgggagaagtg
acagggctacgcttgctcgatatcgatctgccagcaacctacgccgcccagttccccggc
cctcaattcggcattagcggaacccgcgacttcgctaaggtctacgacagaccaatgatc
ggcaccatcattaagccgagcattggcttgcttcccgcacagacggcagagatcgtcgac
agtctctgtgccgcagacatcgatttcatcaaggacgacgagcttctcgctgatcccaca
tacgcgagcttcgacgagcgtctcgcagccgtcatgcccgtcctgcatcggcacgccgac
cgcatgggacgtatgcccatgtacgcaatcaacatctcgggcacaatcgacgagatgctc
cagcgacacgatgcggtggtacgggcgggcggtacttgcgtgatgatttgcattaattgg
gtcggctttgctggcgtcgagcaccttcgcaagcatgcccagctgcccatccacggtcac
cgcaatggttggggcgcactcacccgctatccgcaactcgggttctcctttaaggcgtat
cagaagctgtggcgacttgctggggtggatcaactgcacgtcaacggcattcgcagcaag
ttctgggaaccagacgcgtccgtcatcgaatcggcccgtgcctgcctgacaccattcgcg
ggcgtgcagccgttgatgcccgttttttcatctggccagtgggcgtcgcaagcccctgat
ctttatgctcagttgggttccgtagacctgatgcatttggcgggcggcggaatcatcgga
catccgcatggaattgccgcgggcgttgcaagtatgcgggaagggtgggaagcagctgtc
gaagggatcgacctgaacaccttcgcggagtcccgacctgcgctgcgtgctgcgctgtct
cactttcaatcggcgtga

DBGET integrated database retrieval system