KEGG   Bacillus sp. OxB-1: OXB_0483Help
Entry
OXB_0483          CDS       T03635                                 

Definition
(GenBank) D-alanine--D-alanine ligase b
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
baco  Bacillus sp. OxB-1
Pathway
baco00473  D-Alanine metabolism
baco00550  Peptidoglycan biosynthesis
baco01100  Metabolic pathways
baco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:baco00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    OXB_0483
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OXB_0483
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    OXB_0483
Enzymes [BR:baco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     OXB_0483
Peptidoglycan biosynthesis and degradation proteins [BR:baco01011]
 Precursor biosynthesis
  Amino acid ligase
   OXB_0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 DUF5346 TTL
Motif
Other DBs
NCBI-ProteinID: BAQ08955
UniProt: A0A0A8JEE3
LinkDB All DBs
Position
complement(493662..494729)
Genome map
AA seq 355 aa AA seqDB search
MKKKLGLVYGGKSAEHEVSLSTARAVTNAIDFGKYEVIPIYITYEGEWRKGKPLAQPAQT
IEELRLEGEGASKPDTIQSFLNGEGLPDIVFPLLHGTNGEDGTVQGLFEVMNLPYVGNGV
LASSAGMDKVVMKQLFAQVGLEQVPYVHFIRSDWKKGKEQWLDRMEQELSWPMFVKPANL
GSSVGISKAADRQELSDAVELALKFDRKIIVEQGVTAREIEMGVLGNDEPACSVTGEIKP
IAAFYDYEAKYQDDSTELVIPADIPDEVAAKMEDMALRAYKVLDCAGLVRADFFVTAANE
VLINEVNTMPGFTPTSMFPLLWQKTGVSYPELIDKLIELAWERHTEKQTLQYTMD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaagttaggattggtctacggaggcaagtcggcggagcatgaggtttcatta
tcgacagcacgggctgtgacgaatgcaatcgatttcggaaaatatgaagtgattccgatt
tatataacgtatgagggcgaatggcgtaaaggcaagccgcttgcacaacctgcccaaacg
attgaggagctgcggctcgaaggggaaggggccagtaagccggacacaatacagagcttt
ttgaacggggaagggctccctgatatcgtttttcctctgttgcacggaacgaatggcgag
gatggaacggtccaagggctattcgaagtgatgaacttgccgtatgtcgggaacggggta
ctcgcttcgtcggccggcatggacaaagtcgtcatgaagcaattgttcgcgcaagtcggc
ttggagcaagtgccctatgtccattttatccgaagcgattggaagaaagggaaggagcag
tggttggaccggatggaacaggagctgagctggccgatgttcgtcaagcctgcgaatctc
gggtccagtgtcggcatcagtaaagcggcggaccgccaagagttgagtgatgcggttgaa
ctggctctgaaatttgaccggaagatcattgtggaacaaggggtcactgcgcgtgaaatc
gaaatgggcgttctcggcaatgacgaacccgcctgctccgttacaggagaaatcaaaccg
atcgccgctttttacgattacgaagcgaaataccaagacgatagcacggaactggtcatt
cctgccgacatcccggatgaagtggctgccaagatggaagacatggcgctccgtgcatac
aaagtattggattgtgcgggactcgtgcgagctgacttcttcgtgacagctgcaaatgaa
gtcctcatcaatgaagtgaacacgatgcccggtttcacgccgacgagcatgtttccattg
ctttggcaaaaaacaggtgtctcctatcccgaattgatcgataaactgattgaattggca
tgggagcggcatacggaaaaacagacattacaatatacaatggattga

DBGET integrated database retrieval system