KEGG   Bacillus sp. OxB-1: OXB_2905Help
Entry
OXB_2905          CDS       T03635                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
baco  Bacillus sp. OxB-1
Brite
Enzymes [BR:baco01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     OXB_2905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAQ11376
UniProt: A0A0A8JLT9
LinkDB All DBs
Position
complement(2928738..2929340)
Genome map
AA seq 200 aa AA seqDB search
MAYTLPELPYAYDALEPHIDKETMNIHHTKHHNTYITNLNNALEGNDELLSKSIEELISD
MDAIPEDKRTAVRNNGGGHANHSFFWQILSPNGGGNPSGALAEAIDKKFGSFDAFKEEFA
KAGATRFGSGWAWLVLNNGELEVMSTANQDSPLMEGKTPLLGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVAKRYGK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttacactttaccagaattgccatacgcatacgatgcgttagaaccccacattgac
aaagaaacgatgaacatccatcacacgaaacaccacaacacgtacatcacaaacttgaac
aacgcacttgaaggaaacgacgaattgctaagcaaatcgatcgaagaacttatttccgat
atggatgcgattccagaagacaaacggacggctgtccgcaacaatggcggcggccacgcg
aaccactcattcttctggcaaatcctttctccaaatggcggaggtaacccatccggtgct
ttggcagaagcgatcgacaagaaattcggcagctttgacgcattcaaagaagagtttgcg
aaagcaggtgcaactcgtttcggttccggttgggcttggctcgttctgaacaatggtgaa
cttgaagtgatgtccactgcaaaccaagactccccattgatggaaggcaaaacgccgctg
ctcgggcttgacgtttgggagcatgcgtattacctgaactatcaaaaccgtcgcccggat
tacatttcagcgttctggaatgtcgtcaattgggacgaagtggcaaaacgttacggaaaa
taa

DBGET integrated database retrieval system