KEGG   Bacillus sp. Pc3: SB24_17070Help
Entry
SB24_17070        CDS       T03544                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bacp  Bacillus sp. Pc3
Brite
Enzymes [BR:bacp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SB24_17070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3536123..3536728
Genome map
AA seq 201 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL
NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEPTGELAEEIKSTFGSFDQFKEKFAA
AAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRPDY
ISAFWNVVNWDEVARLYSEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaattgccttacgcttatgatgctttagaacctcatatcgat
aaggaaacgatgacgattcaccatacgaagcaccataacacatacgtgacaaacctcaac
aaagcgatcgaaggatctgcgcttgcagagaaatctgtagatgagcttgttgctgatttg
aacgcagtgccggaggacatccgcacggcagtccgcaacaatggcggcggacatgcaaac
cactctttattctggactcttttatctccgaacggcggaggcgaaccgactggtgagctt
gctgaagagatcaaaagcacgttcggaagcttcgatcaatttaaagaaaaattcgccgca
gcagctgcaggccgtttcggttcaggctgggcttggctcgttgtaaacaacggcaaactt
gaaattacaagcacgccaaaccaagattcaccgctttcagaaggtaaaacacctgttctc
ggtcttgatgtttgggagcatgcgtactacctgaactaccaaaaccgccgtcctgattac
atttcagctttctggaatgttgtgaactgggatgaagttgcccgtctttacagcgaagca
aaataa

DBGET integrated database retrieval system