KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103000123Help
Entry
103000123         CDS       T03086                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103000123 (HK1)
   00051 Fructose and mannose metabolism
    103000123 (HK1)
   00052 Galactose metabolism
    103000123 (HK1)
   00500 Starch and sucrose metabolism
    103000123 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    103000123 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103000123 (HK1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    103000123 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103000123 (HK1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    103000123 (HK1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    103000123 (HK1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103000123 (HK1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103000123 (HK1)
Membrane trafficking [BR:bacu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103000123 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 921 aa AA seqDB search
MGQTCQRGWGTATESPIQPPLTQSKIDKYLYAMRLSDETLLDIMARFRKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQKQTVHMESEVYDTPE
NIMHGSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKRFK
ASGVEGTDVVKLLEKAIKKRGDYDANVVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAREIL
TRLGVEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAH
FSLTKDMLLEVKRRMRAEMELGLGKQTHDKAVVKMLPSFVRSTPDGTEHGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPTEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCKQTSLDAGILITWTKGFKATDCVGQDVATLLRDAVKRREEFDLDVVAVVN
DTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVETLEGSEGRMCINMEWGAFGDNG
CLDDIRTIYDKLVDEYSLNGGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEPL
KTRGIFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGA
GMAAVVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDG
SGKGAALITAVGVRLRQETSS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggggcagacctgccagcgaggatggggtacagcaactgaaagtccaattcagcccccg
ctcactcaaagtaagatcgacaaatatctctatgccatgcggctctctgatgaaactctg
ttagatatcatggctcgtttcagaaaggagatgaagaatggcctctcccgggattttaat
ccgacagccacagtcaagatgttgccaacgtttgtaaggtccattcctgatggttcagaa
aagggagatttcattgccctggatcttggcgggtcttcctttcgaattctgcgggtgcaa
gtgaatcatgagcaaaaacagactgttcatatggagtccgaggtttacgacaccccagag
aacatcatgcacggcagtggaagccagctttttgatcatgtcgctgagtgcctgggagac
ttcatggagaaaaaaaaaatcaaggacaagaaattacctgtcggattcacgttttctttc
ccttgtcggcaatccaaaatagacgaggccatcctgatcacctggacaaagagatttaaa
gcgagtggagtggagggaacggatgtggtgaagctgcttgagaaagccatcaaaaagcgc
ggggactatgacgccaacgttgtggctgtggtgaacgacactgtggggaccatgatgacc
tgtggctacgacgaccagcagtgtgaagtcggcctcatcattggcacgggcaccaacgcg
tgctacatggaggaactgaggcacatcgacctggtggaaggcgacgaggggaggatgtgc
atcaacaccgagtggggggccttcggggacgacggggccctggaggacatccgcactgag
ttcgaccgggagattgaccgcggctcactcaaccccgggaagcagctgtttgagaagatg
gtcagtggcatgtacatgggcgagctggtccgattgatcctggtcaagatggccaaggag
ggcctcttatttgaagggcggatcaccccggagctgctcaccagagggaagtttaacacc
agtgacgtgtcagccattgaaaagaataaggaaggcctccacaatgccagagaaatcctg
acccgcctgggagtggagccatctgatgacgactgtatttcggtccagcacgtgtgcacc
attgtctcgttccgctctgccaacctagtggctgcgacgctgggcgccatcctgaatcgt
cttcgagataacaagggcacgcccaggctgcggaccacggttggtgtcgacgggtctctt
tacaagacgcacccacagtattcccggcgtttccacaagaccctgaggcgcttggtgccc
gactgcgatgtgcgtttcctcctctcggagagtggcagtggcaagggggctgccatggtg
accgcggtggcctaccgcctggctgagcagcaccggcagatagaggagaccctggcccac
ttcagtctcaccaaggatatgctgctggaggtgaaaaggaggatgcgggccgagatggaa
ttggggctgggcaagcagacgcatgacaaggccgtcgtcaagatgctgccctccttcgtc
cggagcactcctgatgggacagagcacggtgacttcttggccctggatcttggaggaacg
aatttccgcgtcttgctggtgaaaattcgtagtgggaaaaagagaacagtggaaatgcac
aacaagatctacgccattcccacggaaatcatgcagggcactggggaagagctgtttgac
cacatcgtttcctgcatctctgacttcctggactacatgggcatcaagggccccagaatg
cctctgggcttcacgttttcgtttccctgcaagcagactagcttggatgcgggaatcttg
atcacctggacgaaaggttttaaggcaactgattgcgtggggcaggatgtagcaacctta
ctgagggatgcggtaaaaaggagagaggaatttgacctggacgtggtggctgtggtcaat
gacacggtgggcaccatgatgacctgtgcttatgaggagcccacctgcgaggttggactc
atcgtagggacgggcagcaatgcctgctacatggaagaaatgaaaaacgtcgagacgcta
gaaggaagcgagggccgaatgtgtatcaacatggagtggggtgcctttggggacaacggg
tgtctggatgatatcagaacgatctatgacaaactggtggatgaatattctctaaacggc
gggaagcaaaggtatgagaagatgatcagcggcatgtacctgggtgaaatcgtccgcaac
atcttgattgacttcaccaagaggggattcctcttccgagggcagatctctgagcctctg
aagactcggggcatctttcagaccaagtatctctctcagatcgagagcgatcgattagcg
ctgctgcaggtccgggccatcctccagcagcttggcctgaacagcacgtgcgacgacagc
atcctcgtgaagaccgtgtgcggggtagtgtccaagagggccgcgcagctgtgcggcgcg
ggcatggctgccgtggtggataagatccgcgagaacagggggctggaccacctcaacgtg
actgtgggcgtggacggcacgctctacaagcttcatccgcacttctccagaatcatgcac
caaaccgtgaaggaactgtcaccaaagtgtaacgtgtccttcctcttatccgaagatggt
agcggcaagggagccgccctcatcacggcagtgggcgttcggctccggcaagaaacgagc
agctaa

DBGET integrated database retrieval system